Os02t0776400-01

Locus

Os02g0776400

Description

Similar to nuclear transcription factor Y subunit A-3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAP2K

CGSNL Gene Name

HAP2 SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP2K, NF-YA11, OsNF-YA11, NFYA11

Oryzabase Gene Name Synonym(s)

NUCLEAR FACTOR-Y subunit A11, NUCLEAR FACTOR-Y subunit NF-YA11, NF-YA transcription factor 11, NF-YA subunit 11, NF-YA family 11

Transcript Evidence

AK318574 (DDBJ, Best hit)

Protein Evidence

NP_001149075.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Functional domain (InterPro)

CCAAT-binding transcription factor, subunit B (IPR001289)

Full-length cDNA

J090045B17 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0776400-01)

Others

Oryzabase (20922)

KEGG (Os02t0776400-01)

Transcript

1150 bp

>Os02t0776400-01 Similar to nuclear transcription factor Y subunit A-3.
AGgggggcagcagcggaagcgacggcggggaggagccgaggaggctgcaggcgcagcgag
cagcagcagcttcttcgctcggcggaggcaccgagggaggaggcgcgTGGTAGCCATGCT
TCTCCCCTCATCGTCTTCTTATTCCTACGCCTCCAAAGGTGACTCCTTCAGGAGAACTGT
TGATGGTCCTATGAGGTCAACGTTGACTTTTGATAATAATCATTCTGTAGTGCCAAGTCA
AAACATTGATTACGGCCAGCCAATGGCTTGCATTTCATACCCATACAACGATTCTGGTTC
AGGAGTTTGGGCATCCTACAGTTCACGCTCGGTGTTCCATCCTCAAATTGTGGGAGGAGG
CACATCGCCAAGAGTTCCCTTGCCCTCCCTGGAGATAGCAGATGATGGGCCCATATATGT
CAATCCCAAACAATATCATGGAATTCTTCGCAGAAGACAACTGCGTGCTAAGTTAGAGGC
CCAGAATAAGCTCGTCAAAACCCGAAAGCCTTACCTTCACGAATCTCGGCATCGCCATGC
AATGAAGAGGGCTAGGGGCACTGGTGGGCGATTCCTGAATACCAAGCAGCTCCAGCTGCA
GCAACAGTCTCACACTACCTCCACCAAGACCACCACAGACAGCCAAAATTCTTCAGGTTC
AGTCCATCTACGGCTAGGTGGTGGCGCAATCGGAGATCAAACTCCATTTCCGTTCAAAGC
AATGGATTCACAAGCTAACATCAAGAGAGCTGCAGCTTCTGCTTCCACCTTCACTGTAAC
TTCTGCGGCACAGAAAGACGACGCCTTCTTCGACCGCCATGGCCACCATCTCAGTAGCTT
CTCCGGCCATTTTGGCCAGGCAAGCGCACAAGGTGGCGTCGGCAGCATGCATAACGGGTC
ACAGCAGAGGGTTCCTGCTATGAGATGAGATGAAGAGCAGCTTGCAAATCATCATCATAT
ATGGTGTGGTCTGGTCCCTCCTTAGGCAATTCATCCTTGGCTTAAGTTTCATGGCTTGTT
TAGGACTTCAGAGACGCTTCATAGTGCTGTGCTTTTGCAGCCCATAAGTCTGGGCTTAAT
TGTGATGTGTAATATCCATGTATTGGTGTGATGAAGTTGTCCCTGTTTGAATAAACTCTT
TGTCTGTTGG

CDS

813 bp

>Os02t0776400-01 Similar to nuclear transcription factor Y subunit A-3.
ATGCTTCTCCCCTCATCGTCTTCTTATTCCTACGCCTCCAAAGGTGACTCCTTCAGGAGA
ACTGTTGATGGTCCTATGAGGTCAACGTTGACTTTTGATAATAATCATTCTGTAGTGCCA
AGTCAAAACATTGATTACGGCCAGCCAATGGCTTGCATTTCATACCCATACAACGATTCT
GGTTCAGGAGTTTGGGCATCCTACAGTTCACGCTCGGTGTTCCATCCTCAAATTGTGGGA
GGAGGCACATCGCCAAGAGTTCCCTTGCCCTCCCTGGAGATAGCAGATGATGGGCCCATA
TATGTCAATCCCAAACAATATCATGGAATTCTTCGCAGAAGACAACTGCGTGCTAAGTTA
GAGGCCCAGAATAAGCTCGTCAAAACCCGAAAGCCTTACCTTCACGAATCTCGGCATCGC
CATGCAATGAAGAGGGCTAGGGGCACTGGTGGGCGATTCCTGAATACCAAGCAGCTCCAG
CTGCAGCAACAGTCTCACACTACCTCCACCAAGACCACCACAGACAGCCAAAATTCTTCA
GGTTCAGTCCATCTACGGCTAGGTGGTGGCGCAATCGGAGATCAAACTCCATTTCCGTTC
AAAGCAATGGATTCACAAGCTAACATCAAGAGAGCTGCAGCTTCTGCTTCCACCTTCACT
GTAACTTCTGCGGCACAGAAAGACGACGCCTTCTTCGACCGCCATGGCCACCATCTCAGT
AGCTTCTCCGGCCATTTTGGCCAGGCAAGCGCACAAGGTGGCGTCGGCAGCATGCATAAC
GGGTCACAGCAGAGGGTTCCTGCTATGAGATGA

Protein

271 aa

>Os02t0776400-01 Similar to nuclear transcription factor Y subunit A-3.
MLLPSSSSYSYASKGDSFRRTVDGPMRSTLTFDNNHSVVPSQNIDYGQPMACISYPYNDS
GSGVWASYSSRSVFHPQIVGGGTSPRVPLPSLEIADDGPIYVNPKQYHGILRRRQLRAKL
EAQNKLVKTRKPYLHESRHRHAMKRARGTGGRFLNTKQLQLQQQSHTTSTKTTTDSQNSS
GSVHLRLGGGAIGDQTPFPFKAMDSQANIKRAAASASTFTVTSAAQKDDAFFDRHGHHLS
SFSGHFGQASAQGGVGSMHNGSQQRVPAMR*

5'UTR

chr02:32798226..32798340 (- strand) : 115 bp

CDS

chr02:32798183..32798225 (- strand) : 43 bp

chr02:32795973..32796079 (- strand) : 107 bp

chr02:32795803..32795871 (- strand) : 69 bp

chr02:32795004..32795177 (- strand) : 174 bp

chr02:32794451..32794870 (- strand) : 420 bp

3'UTR

chr02:32794229..32794450 (- strand) : 222 bp

FASTA

>Os02t0776400-01 class=Sequence position=chr02:32794229..32798340 (- strand)
AGgggggcag cagcggaagc gacggcgggg aggagccgag gaggctgcag gcgcagcgag cagcagcagc ttcttcgctc
ggcggaggca ccgagggagg aggcgcgTGG TAGCCATGCT TCTCCCCTCA TCGTCTTCTT ATTCCTACGC CTCCAAAGGT
CATAATCCAA ACCTTTCTCT TCTCCCTTCC TAGACGATGT AGCAGTAGCT ATACCCCTGA TCTTGTGCAA GTGCTGAGAC
CACTGGGTAA TCTTGGTTTC TTGGAGCATA TGTTTGTTTG CTGATCTTGT GCAAGTGCTG AGACCACTGG GTAATCTTGG
TTTCTTGGAG CATATGTTTG TTTGAGTGCG TGTTCTTGAT CTCCAATCTC CTGGGTAGTT TGTCATGCTT GACTTTTCGT
AGTCAAAGAA CGATTCTTTT ATAGGATTGT AATGGAGCAT ATTCTTGATG CCGAGGCTTA TTACGCTTAG TGTTTGTGGA
TTTGACTGGA TGCATGTCGT TTTGGCACAA AGATTGATTG AGTATGGAGA TTGTTGACTA GTCGTGTGTG GCTTGTAAGG
CTACTATTGG ATGTCTTTGG GGCTCTAGGG AGGATCTCTC AAGTCTCAGT GTCAGACTCG ATGGCAGCAG TTGTTGTCAT
GCATGTTCTT GGGAATTTAG ATCATATATC ATCATCATAT AAGCTTGTGT TTATCACTTG ATGTGGGAAC ATTTCTAGTG
CTGCCTTTCT CTCGACCATA TTTGAGGACG AGTGATGTGT TGATGACTGA TGAAGTGATG ATATACTCGG ACTATAGAAA
TTCAGTCCAC CTATTCTGTG TGTTCCTATA GATAATTTCC TGCTGGTTAA TACTCTTTAT ATTTGTTGTA TCTTTAGGTT
GTGTTGTATG GATTTATTTG GTATATTTTG CTTCGGTTGT ATTTTCCCAG TGCTATTCAT ATACAGTACA TGACAGTCTT
GCTTTTTTTT TTCTGAAGGA AGTTTTTGGT TTGTTGATCT TTGTCTACAA AACATAGCTA AATATGGGAC AAAGGAACTG
TATTTTTCCG ACTTTTAAGA ATTAAAATGA CAGATCAATG AAATCTTGTG TGTTTTAGCT CTGCCAATTA GCTAAACTTG
GGTCATATCT GAGGCTTACT CGAGGAAAAC ACCAAGATAG ACATTATGAA CTTGGCAGTT GGCACATTGA ACAAACAGTT
CATTTTGTGG CACGTGCATT TATTATCTAG CATATTAGAT GAGTTTATTA GTTTCAATTA AGACATCAAT TAGAAAGATT
GGAGGAATAT TATTTCTTTG GCAAGCATCT TCTTCAATGT TAGCATAAGT ACAACCTCTA GTTACAAAGA AACAATGCTG
CCCTCAAACA TTTTTGTGTT AGACCATTCA TTTTAACTAT TCTTTTTTTG AAACCGATCA TTTTAACTAT TCTCTCCGTC
CCAAAATTTA GCGACTAGtc ctaggttgct atattttggg atggagggag taGAATTTTC TTGACCTTTT TGAGAGTCCA
AAGCACTCAC TAAACTCAGA ATGTACCACA TTCAAGCCCT GGTGAAGCAC ATGTGCAAAT TTCCACACTG AAACATGCAC
AAATATGTAT CCATGTGTGC TTCTTAAATT GGACAACATC AACACTTGTA GTACCTAGCA GTCGGGCCAT TTCAGAAAGT
AGAAAATTTT ATTTTGTTTT GTTTGCCTAA ACGTAGTAAA TAAGAAGCTT GTTGATAAAC GCAAGATTCA TGTCCTGTCC
TGGCTGATTC ACTAAACAGA TAGTAGTATC TTCAAGAAGC AACTAAATAT GTATTCCTGA AAAACTAGGT AGAAGGGACA
AGATATTGAC ATAAATTTGT GGAGGTAAAT TTAAAACATT GCTTGCTACG CATGAGTGAT ACCTGCTTAT AAGCATaagc
aataatttga attgaaaact taattttcga gttgattttg gtatattttc atcatactag tttattttac agcatttgcc
tttatatcac taagaacaca tatataaaag ttttacccat aaattatttt ttaatcacta ataaaccgtt tcacttataa
taagtataag cgaaacgacg aggctgctaa ATTCTACACA AGTACTGAAT CTAAACTTTC TGAGGATGTT ATTCTCTTTT
GTTGTTTATC TGGTTTGGAT AATGCCAGGA TACTTCCTGT GTTTCCTCAT GATTCCTTTT GTAATTTATC AACCTACACT
ACATTTTCCT GCTGTCACCA GGTGACTCCT TCAGGAGAAC TGTTGATGGT CCTATGAGGT CAACGTTGAC TTTTGATAAT
AATCATTCTG TAGTGCCAAG TCAAAACATT GATTACGGCC AGCCAATGGT AAGATATGCT AATGGAGCCA ACATTAGATC
TGGCAAAGTC AGCTCATCCT ATTCTTTATA AGTAACCGTG CATCTGATTA TTTTCTGTAT ATTTCACAGG CTTGCATTTC
ATACCCATAC AACGATTCTG GTTCAGGAGT TTGGGCATCC TACAGTTCAC GCTCGGTGGT ATGTTCTTCT AACAAGTTCT
CTCTCAATTC TCTCAAGGTC TTCAAACTTT TGCAGAGGAA GCTAACAAAC TAGTAGTAAC ATTTTTTTTA TCAACATATG
TAATTATAAG GGTATAATTC ATGCATCCAG GTCCTGCTTA GGAGATCCCA TTATTTATCT ATGATCAGTC CAGCCTGATT
TGATTTAGTC TAGAGGCTTA AAATATGTCA CTTTTCCCAT TTGTCGTAAA GAAACTGCCT GGTTTTGCAT AAAAATGGAT
TGAGTCATCA ACGTAACCTC AACAGGGTAG TATGTCTGAA GCTCTTTATA TAGCACAAAA AGATTACCTT TGAGCATTAT
TTTAGGTTTT GCCAACCTCA CCTGTAAATG GTGTAGGTTG ATGCATTAAA TTAAACTAGT GAGAAGACAT AACTAATGTC
TATTTGAGTA ATGCAGTCAC ATGCAGTTCA TAATTCTTAA GAACTAGTAC TAGATATACG TGAGTTTATT CACTAGATCA
ATATTATTCA GGGAGAACAT GTAGTAGTTA TGCAAACCAT GTGCACACAC ATCTCTTGGG GCATCCAGCT TATTTTTATC
TATATTTTCA TGGGTCTTGC CTAATCAGTT GTACTTAAAA CAGTTCCATC CTCAAATTGT GGGAGGAGGC ACATCGCCAA
GAGTTCCCTT GCCCTCCCTG GAGATAGCAG ATGATGGGCC CATATATGTC AATCCCAAAC AATATCATGG AATTCTTCGC
AGAAGACAAC TGCGTGCTAA GTTAGAGGCC CAGAATAAGC TCGTCAAAAC CCGAAAGGTT CTTGCCACTG CCAACTGATC
CATTGATGTT TTTACCTTCC ATTGCCATCT CCTTGTGCAT CTTGCATTAA CCTTTTAATA TTGTTAACCA CTCTGCTTGG
CTTAATATTG TAAACAATCT CCATGTGCAG CCTTACCTTC ACGAATCTCG GCATCGCCAT GCAATGAAGA GGGCTAGGGG
CACTGGTGGG CGATTCCTGA ATACCAAGCA GCTCCAGCTG CAGCAACAGT CTCACACTAC CTCCACCAAG ACCACCACAG
ACAGCCAAAA TTCTTCAGGT TCAGTCCATC TACGGCTAGG TGGTGGCGCA ATCGGAGATC AAACTCCATT TCCGTTCAAA
GCAATGGATT CACAAGCTAA CATCAAGAGA GCTGCAGCTT CTGCTTCCAC CTTCACTGTA ACTTCTGCGG CACAGAAAGA
CGACGCCTTC TTCGACCGCC ATGGCCACCA TCTCAGTAGC TTCTCCGGCC ATTTTGGCCA GGCAAGCGCA CAAGGTGGCG
TCGGCAGCAT GCATAACGGG TCACAGCAGA GGGTTCCTGC TATGAGATGA GATGAAGAGC AGCTTGCAAA TCATCATCAT
ATATGGTGTG GTCTGGTCCC TCCTTAGGCA ATTCATCCTT GGCTTAAGTT TCATGGCTTG TTTAGGACTT CAGAGACGCT
TCATAGTGCT GTGCTTTTGC AGCCCATAAG TCTGGGCTTA ATTGTGATGT GTAATATCCA TGTATTGGTG TGATGAAGTT
GTCCCTGTTT GAATAAACTC TTTGTCTGTT GG

Locus: Os02g0776400

Loading...

Locus: Os02g0776400

Loading...