Os02t0776900-01

Locus

Os02g0776900

Description

Transcription activator, Gibberellin (GA)-induced stem elongation

RAP-DB Gene Symbol Synonym(s)

GRF1, OsGRF1

RAP-DB Gene Name Synonym(s)

GROWTH-REGULATING FACTOR 1, growth-regulating factor1

CGSNL Gene Symbol

GRF1

CGSNL Gene Name

GROWTH-REGULATING FACTOR 1

Oryzabase Gene Symbol Synonym(s)

OsGRF1

Oryzabase Gene Name Synonym(s)

growth-regulating factor1

Transcript Evidence

BK004856 (DDBJ)

AF201895 (DDBJ)

Protein Evidence

Q6AWY8 (UniProt)

Q9SDZ5 (UniProt)

Literature

PMID: 10712532

PMID: 15295073

Note

Manual Curation

July 22, 2010

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein binding (GO:0005515)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides (GO:0016818)

Functional domain (InterPro)

WRC (IPR014977)

Glutamine-Leucine-Glutamine, QLQ (IPR014978)

Expression Databases

TENOR (Os02t0776900-01)

Others

Oryzabase (3074)

Transcript

1878 bp

>Os02t0776900-01 Transcription activator, Gibberellin (GA)-induced stem elongation
TTACAAAACCCCAGCCACCGAGAGCTCTCCCGCTCCACTCGCCGCACACCACCACCCTCA
CCCCTCCCCCCATCCGCGTGATCTCCCGAGCAGCTAGAGCGCGCGCCCGCGGCGCCTGTA
CTGCGAGACCGCTTCGCTCGCTTCCGGTCGGTGAAGAGGCGGTCGGTCGCAGCTGAAGTA
GTTGTTGCAGAGATGATgatgatgagcggtcgcccgagcggcggcgccggcggaggtcgg
tacccgttcacggcgtcgcagtggcaggagctggagcaccaggcgctcatctacaagtac
atggcgtccgggactcccatcccctccgacctcatcctccccctccgccgcagcttcctc
ctcgactccgccctcgccacctccccttccctcgccTTCCctccccaaccttcactgggg
tggggttgctttggcatggggtttgggcggaaggcggaggacccggagccagggcgatgc
cggcgtacggacggcaagaagtggcggtgctccaaggaggcgtacccggactccaagtac
tgcgagaagcacatgcaccgtggcaagaaccgttcaagaaagcctgtggaaatgtccttg
gccacgccgccgccgccGTCCTCCtccgccacctccgccgcgtcgaacacctccgccggc
gtcgcccccaccaccaccaccacctcctccccggcgccctcctacagccgcccggcgccg
cacgacgcggcgccgtaccaggcgctctacggcgggccctacgccgcggccaccgcgcgc
acccccgccgccgcggcgtaccacgcGCAGGTGAGCCCGTTCCACCTCCAGCTCGACACC
ACCCACCCGCACCCGCCGCCGTCCTACTACTCCATGGACCACAAGGAGTACGCGTACGGG
CACGCCACCAAGGAGGTGcacggcgagcacgccttcttctccgatggcaccgagagggag
caccaccacgccgccgccgGGCACGGCCAGTGGCAGTTCAAGCAGCTCGGCATGGAGCCC
AAGCAGAGCACCACGCCTCTCTTCCCGGGCGCCGGCTACGGCCACACCGCGGCGTCGCCG
TACGCCATTGATCTTTCAAAAGAGGACGACGATGAGAAAGAGAGGCGGCAACAGCAGCAG
CAGCAGCAGCAGCAGCACTGCTTCCTCCTGGGCGCCGACCTCCGTCTGGAGAAGCCGGCG
GGCCACGACCACGCGGCGGCGGCGCAGAAACCTCTCCGCCACTTCTTCGACGAGTGGCCG
CATGAGAAGAACAGCAAGGGCTCCTGGATGGGGCTCGAAGGCGAGACGCAGCTGTCCATG
TCCATCCCCATGGCCGCCAACGACCTCCCGATCACCACCACCTCCCGCTACCACAATGAT
GATTAATCTCTTGAAGAAGCCAAGAAGTGATCAACACGCGGAAGAAATCAACAGCTTCTT
TCACGGCGTGCGAGCTGCATGCTGATGCTCCAGGATCGATCGATCGATCATTGCATCTCC
AAACTAATCACGCTTCGATCTTTCAGGACTTCATCAATGACAGGCCGAAACCTCCTACGA
GTTCTCTGATGATATTCTTATTTTTTTCCCACTTCTTTTCGTTGAGCTTTTTGTAATGTT
GCTTCGAGTGTTACTCCTACATTTTCTCCGAAATGGCCTCAGAATGATGCGGTCGGGCTG
ATTAATTAGGTTAGACTCTTCCTGAACCAACTAGGAATAGATTTTCTGCCTGGTTCCTGT
CAGTCCTTGTAATATCTGCAGCAGCTTGTGAGACAAGCGTGTTCGCTTTTGTGAACGCCC
TTTTTCTTCTTTCCGATTCCTCTGCCTGTGATAgtactcgctccgaaaaaaaaaaaaaaa
gcaaaccgtggattcttg

CDS

1194 bp

>Os02t0776900-01 Transcription activator, Gibberellin (GA)-induced stem elongation
ATGATgatgatgagcggtcgcccgagcggcggcgccggcggaggtcggtacccgttcacg
gcgtcgcagtggcaggagctggagcaccaggcgctcatctacaagtacatggcgtccggg
actcccatcccctccgacctcatcctccccctccgccgcagcttcctcctcgactccgcc
ctcgccacctccccttccctcgccTTCCctccccaaccttcactggggtggggttgcttt
ggcatggggtttgggcggaaggcggaggacccggagccagggcgatgccggcgtacggac
ggcaagaagtggcggtgctccaaggaggcgtacccggactccaagtactgcgagaagcac
atgcaccgtggcaagaaccgttcaagaaagcctgtggaaatgtccttggccacgccgccg
ccgccGTCCTCCtccgccacctccgccgcgtcgaacacctccgccggcgtcgcccccacc
accaccaccacctcctccccggcgccctcctacagccgcccggcgccgcacgacgcggcg
ccgtaccaggcgctctacggcgggccctacgccgcggccaccgcgcgcacccccgccgcc
gcggcgtaccacgcGCAGGTGAGCCCGTTCCACCTCCAGCTCGACACCACCCACCCGCAC
CCGCCGCCGTCCTACTACTCCATGGACCACAAGGAGTACGCGTACGGGCACGCCACCAAG
GAGGTGcacggcgagcacgccttcttctccgatggcaccgagagggagcaccaccacgcc
gccgccgGGCACGGCCAGTGGCAGTTCAAGCAGCTCGGCATGGAGCCCAAGCAGAGCACC
ACGCCTCTCTTCCCGGGCGCCGGCTACGGCCACACCGCGGCGTCGCCGTACGCCATTGAT
CTTTCAAAAGAGGACGACGATGAGAAAGAGAGGCGGCAACAGCAGCAGCAGCAGCAGCAG
CAGCACTGCTTCCTCCTGGGCGCCGACCTCCGTCTGGAGAAGCCGGCGGGCCACGACCAC
GCGGCGGCGGCGCAGAAACCTCTCCGCCACTTCTTCGACGAGTGGCCGCATGAGAAGAAC
AGCAAGGGCTCCTGGATGGGGCTCGAAGGCGAGACGCAGCTGTCCATGTCCATCCCCATG
GCCGCCAACGACCTCCCGATCACCACCACCTCCCGCTACCACAATGATGATTAA

Protein

398 aa

>Os02t0776900-01 Transcription activator, Gibberellin (GA)-induced stem elongation
MMMMSGRPSGGAGGGRYPFTASQWQELEHQALIYKYMASGTPIPSDLILPLRRSFLLDSA
LATSPSLAFPPQPSLGWGCFGMGFGRKAEDPEPGRCRRTDGKKWRCSKEAYPDSKYCEKH
MHRGKNRSRKPVEMSLATPPPPSSSATSAASNTSAGVAPTTTTTSSPAPSYSRPAPHDAA
PYQALYGGPYAAATARTPAAAAYHAQVSPFHLQLDTTHPHPPPSYYSMDHKEYAYGHATK
EVHGEHAFFSDGTEREHHHAAAGHGQWQFKQLGMEPKQSTTPLFPGAGYGHTAASPYAID
LSKEDDDEKERRQQQQQQQQQHCFLLGADLRLEKPAGHDHAAAAQKPLRHFFDEWPHEKN
SKGSWMGLEGETQLSMSIPMAANDLPITTTSRYHNDD*

5'UTR

chr02:32842265..32842456 (- strand) : 192 bp

CDS

chr02:32842042..32842264 (- strand) : 223 bp

chr02:32840983..32841945 (- strand) : 963 bp

chr02:32840860..32840867 (- strand) : 8 bp

3'UTR

chr02:32840368..32840859 (- strand) : 492 bp

FASTA

>Os02t0776900-01 class=Sequence position=chr02:32840368..32842456 (- strand)
TTACAAAACC CCAGCCACCG AGAGCTCTCC CGCTCCACTC GCCGCACACC ACCACCCTCA CCCCTCCCCC CATCCGCGTG
ATCTCCCGAG CAGCTAGAGC GCGCGCCCGC GGCGCCTGTA CTGCGAGACC GCTTCGCTCG CTTCCGGTCG GTGAAGAGGC
GGTCGGTCGC AGCTGAAGTA GTTGTTGCAG AGATGATgat gatgagcggt cgcccgagcg gcggcgccgg cggaggtcgg
tacccgttca cggcgtcgca gtggcaggag ctggagcacc aggcgctcat ctacaagtac atggcgtccg ggactcccat
cccctccgac ctcatcctcc ccctccgccg cagcttcctc ctcgactccg ccctcgccac ctccccttcc ctcgccTTCC
ctccccaacc ttcacgtacg ttacacacat cctcctccac gtacgtacgt acgcgttgtt gccgatgcta acaaagtcca
tattgtgatt ggtgttttct ttggaatgca gtggggtggg gttgctttgg catggggttt gggcggaagg cggaggaccc
ggagccaggg cgatgccggc gtacggacgg caagaagtgg cggtgctcca aggaggcgta cccggactcc aagtactgcg
agaagcacat gcaccgtggc aagaaccgtt caagaaagcc tgtggaaatg tccttggcca cgccgccgcc gccGTCCTCC
tccgccacct ccgccgcgtc gaacacctcc gccggcgtcg cccccaccac caccaccacc tcctccccgg cgccctccta
cagccgcccg gcgccgcacg acgcggcgcc gtaccaggcg ctctacggcg ggccctacgc cgcggccacc gcgcgcaccc
ccgccgccgc ggcgtaccac gcGCAGGTGA GCCCGTTCCA CCTCCAGCTC GACACCACCC ACCCGCACCC GCCGCCGTCC
TACTACTCCA TGGACCACAA GGAGTACGCG TACGGGCACG CCACCAAGGA GGTGcacggc gagcacgcct tcttctccga
tggcaccgag agggagcacc accacgccgc cgccgGGCAC GGCCAGTGGC AGTTCAAGCA GCTCGGCATG GAGCCCAAGC
AGAGCACCAC GCCTCTCTTC CCGGGCGCCG GCTACGGCCA CACCGCGGCG TCGCCGTACG CCATTGATCT TTCAAAAGAG
GACGACGATG AGAAAGAGAG GCGGCAACAG CAGCAGCAGC AGCAGCAGCA GCACTGCTTC CTCCTGGGCG CCGACCTCCG
TCTGGAGAAG CCGGCGGGCC ACGACCACGC GGCGGCGGCG CAGAAACCTC TCCGCCACTT CTTCGACGAG TGGCCGCATG
AGAAGAACAG CAAGGGCTCC TGGATGGGGC TCGAAGGCGA GACGCAGCTG TCCATGTCCA TCCCCATGGC CGCCAACGAC
CTCCCGATCA CCACCACCTC CCGCTACCAC AATGGTGCGT AGAGTACTAA CCTTCGTCTC CACTGATCAG AACCGTTTCT
TGATTCTTAT GGCGAGCCGT GCTGACGATG ATCCAACTTG CTTCCTGTTT GGTCTTGTGC AATCTGCAGA TGATTAATCT
CTTGAAGAAG CCAAGAAGTG ATCAACACGC GGAAGAAATC AACAGCTTCT TTCACGGCGT GCGAGCTGCA TGCTGATGCT
CCAGGATCGA TCGATCGATC ATTGCATCTC CAAACTAATC ACGCTTCGAT CTTTCAGGAC TTCATCAATG ACAGGCCGAA
ACCTCCTACG AGTTCTCTGA TGATATTCTT ATTTTTTTCC CACTTCTTTT CGTTGAGCTT TTTGTAATGT TGCTTCGAGT
GTTACTCCTA CATTTTCTCC GAAATGGCCT CAGAATGATG CGGTCGGGCT GATTAATTAG GTTAGACTCT TCCTGAACCA
ACTAGGAATA GATTTTCTGC CTGGTTCCTG TCAGTCCTTG TAATATCTGC AGCAGCTTGT GAGACAAGCG TGTTCGCTTT
TGTGAACGCC CTTTTTCTTC TTTCCGATTC CTCTGCCTGT GATAgtactc gctccgaaaa aaaaaaaaaa agcaaaccgt
ggattcttg