Os02t0776900-02

Locus

Os02g0776900

Description

Similar to Growth-regulating factor 1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GRF1

CGSNL Gene Name

GROWTH-REGULATING FACTOR 1

Oryzabase Gene Symbol Synonym(s)

OsGRF1

Oryzabase Gene Name Synonym(s)

growth-regulating factor1

Transcript Evidence

AK109652 (DDBJ, Best hit)

Protein Evidence

Q9SDZ5 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

002-140-B03 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0776900-02)

Others

Oryzabase (3074)

Transcript

1397 bp

>Os02t0776900-02 Similar to Growth-regulating factor 1.
TCCACTCGCCGCACACCACCACCCTCACCCCTCCCCCCATCCGCGTGATCTCCCGAGCAG
CTAGAGCGCGCGCCCGCGGCGCCTGTACTGCGAGACCGCTTCGCTCGCTTCCGGTCGGTG
AAGAGGCGGTCGGTCGCAGCTGAAGTAGTTGTTGCAGAGATGATgatgatgagcggtcgc
ccccaccaccaccaccacctcctccccggcgccctcctacagccgcccggcgccgcacga
cgcggcgccgtaccaggcgctctacggcgggccctacgccgcggccaccgcgcgcacccc
cgccgccgcggcgtaccacgcGCAGGTGAGCCCGTTCCACCTCCAGCTCGACACCACCCA
CCCGCACCCGCCGCCGTCCTACTACTCCATGGACCACAAGGAGTACGCGTACGGGCACGC
CACCAAGGAGGTGcacggcgagcacgccttcttctccgatggcaccgagagggagcacca
ccacgccgccgccgGGCACGGCCAGTGGCAGTTCAAGCAGCTCGGCATGGAGCCCAAGCA
GAGCACCACGCCTCTCTTCCCGGGCGCCGGCTACGGCCACACCGCGGCGTCGCCGTACGC
CATTGATCTTTCAAAAGAGGACGACGATGAGAAAGAGAGGCGGCAACAGCAGCAGCAGCA
GCAGCAGCAGCACTGCTTCCTCCTGGGCGCCGACCTCCGTCTGGAGAAGCCGGCGGGCCA
CGACCACGCGGCGGCGGCGCAGAAACCTCTCCGCCACTTCTTCGACGAGTGGCCGCATGA
GAAGAACAGCAAGGGCTCCTGGATGGGGCTCGAAGGCGAGACGCAGCTGTCCATGTCCAT
CCCCATGGCCGCCAACGACCTCCCGATCACCACCACCTCCCGCTACCACAATGATGATTA
ATCTCTTGAAGAAGCCAAGAAGTGATCAACACGCGGAAGAAATCAACAGCTTCTTTCACG
GCGTGCGAGCTGCATGCTGATGCTCCAGGATCGATCGATCGATCATTGCATCTCCAAACT
AATCACGCTTCGATCTTTCAGGACTTCATCAATGACAGGCCGAAACCTCCTACGAGTTCT
CTGATGATATTCTTATTTTTTTCCCACTTCTTTTCGTTGAGCTTTTTGTAATGTTGCTTC
GAGTGTTACTCCTACATTTTCTCCGAAATGGCCTCAGAATGATGCGGTCGGGCTGATTAA
TTAGGTTAGACTCTTCCTGAACCAACTAGGAATAGATTTTCTGCCTGGTTCCTGTCAGTC
CTTGTAATATCTGCAGCAGCTTGTGAGACAAGCGTGTTCGCTTTTGTGAACGCCCTTTTT
CTTCTTTCCGATTCCTCTGCCTGTGATAgtactcgctccgaaaaaaaaaaaaaaagcaaa
ccgtggattcttgggtc

CDS

729 bp

>Os02t0776900-02 Similar to Growth-regulating factor 1.
gcggtcgcccccaccaccaccaccacctcctccccggcgccctcctacagccgcccggcg
ccgcacgacgcggcgccgtaccaggcgctctacggcgggccctacgccgcggccaccgcg
cgcacccccgccgccgcggcgtaccacgcGCAGGTGAGCCCGTTCCACCTCCAGCTCGAC
ACCACCCACCCGCACCCGCCGCCGTCCTACTACTCCATGGACCACAAGGAGTACGCGTAC
GGGCACGCCACCAAGGAGGTGcacggcgagcacgccttcttctccgatggcaccgagagg
gagcaccaccacgccgccgccgGGCACGGCCAGTGGCAGTTCAAGCAGCTCGGCATGGAG
CCCAAGCAGAGCACCACGCCTCTCTTCCCGGGCGCCGGCTACGGCCACACCGCGGCGTCG
CCGTACGCCATTGATCTTTCAAAAGAGGACGACGATGAGAAAGAGAGGCGGCAACAGCAG
CAGCAGCAGCAGCAGCAGCACTGCTTCCTCCTGGGCGCCGACCTCCGTCTGGAGAAGCCG
GCGGGCCACGACCACGCGGCGGCGGCGCAGAAACCTCTCCGCCACTTCTTCGACGAGTGG
CCGCATGAGAAGAACAGCAAGGGCTCCTGGATGGGGCTCGAAGGCGAGACGCAGCTGTCC
ATGTCCATCCCCATGGCCGCCAACGACCTCCCGATCACCACCACCTCCCGCTACCACAAT
GATGATTAA

Protein

243 aa

>Os02t0776900-02 Similar to Growth-regulating factor 1.
AVAPTTTTTSSPAPSYSRPAPHDAAPYQALYGGPYAAATARTPAAAAYHAQVSPFHLQLD
TTHPHPPPSYYSMDHKEYAYGHATKEVHGEHAFFSDGTEREHHHAAAGHGQWQFKQLGME
PKQSTTPLFPGAGYGHTAASPYAIDLSKEDDDEKERRQQQQQQQQQHCFLLGADLRLEKP
AGHDHAAAAQKPLRHFFDEWPHEKNSKGSWMGLEGETQLSMSIPMAANDLPITTTSRYHN
DD*

5'UTR

chr02:32842252..32842423 (- strand) : 172 bp

CDS

chr02:32842242..32842251 (- strand) : 10 bp

chr02:32840983..32841693 (- strand) : 711 bp

chr02:32840860..32840867 (- strand) : 8 bp

3'UTR

chr02:32840364..32840859 (- strand) : 496 bp

FASTA

>Os02t0776900-02 class=Sequence position=chr02:32840364..32842423 (- strand)
TCCACTCGCC GCACACCACC ACCCTCACCC CTCCCCCCAT CCGCGTGATC TCCCGAGCAG CTAGAGCGCG CGCCCGCGGC
GCCTGTACTG CGAGACCGCT TCGCTCGCTT CCGGTCGGTG AAGAGGCGGT CGGTCGCAGC TGAAGTAGTT GTTGCAGAGA
TGATgatgat gagcggtcgc ccgagcggcg gcgccggcgg aggtcggtac ccgttcacgg cgtcgcagtg gcaggagctg
gagcaccagg cgctcatcta caagtacatg gcgtccggga ctcccatccc ctccgacctc atcctccccc tccgccgcag
cttcctcctc gactccgccc tcgccacctc cccttccctc gccTTCCctc cccaaccttc acgtacgtta cacacatcct
cctccacgta cgtacgtacg cgttgttgcc gatgctaaca aagtccatat tgtgattggt gttttctttg gaatgcagtg
gggtggggtt gctttggcat ggggtttggg cggaaggcgg aggacccgga gccagggcga tgccggcgta cggacggcaa
gaagtggcgg tgctccaagg aggcgtaccc ggactccaag tactgcgaga agcacatgca ccgtggcaag aaccgttcaa
gaaagcctgt ggaaatgtcc ttggccacgc cgccgccgcc GTCCTCCtcc gccacctccg ccgcgtcgaa cacctccgcc
ggcgtcgccc ccaccaccac caccacctcc tccccggcgc cctcctacag ccgcccggcg ccgcacgacg cggcgccgta
ccaggcgctc tacggcgggc cctacgccgc ggccaccgcg cgcacccccg ccgccgcggc gtaccacgcG CAGGTGAGCC
CGTTCCACCT CCAGCTCGAC ACCACCCACC CGCACCCGCC GCCGTCCTAC TACTCCATGG ACCACAAGGA GTACGCGTAC
GGGCACGCCA CCAAGGAGGT Gcacggcgag cacgccttct tctccgatgg caccgagagg gagcaccacc acgccgccgc
cgGGCACGGC CAGTGGCAGT TCAAGCAGCT CGGCATGGAG CCCAAGCAGA GCACCACGCC TCTCTTCCCG GGCGCCGGCT
ACGGCCACAC CGCGGCGTCG CCGTACGCCA TTGATCTTTC AAAAGAGGAC GACGATGAGA AAGAGAGGCG GCAACAGCAG
CAGCAGCAGC AGCAGCAGCA CTGCTTCCTC CTGGGCGCCG ACCTCCGTCT GGAGAAGCCG GCGGGCCACG ACCACGCGGC
GGCGGCGCAG AAACCTCTCC GCCACTTCTT CGACGAGTGG CCGCATGAGA AGAACAGCAA GGGCTCCTGG ATGGGGCTCG
AAGGCGAGAC GCAGCTGTCC ATGTCCATCC CCATGGCCGC CAACGACCTC CCGATCACCA CCACCTCCCG CTACCACAAT
GGTGCGTAGA GTACTAACCT TCGTCTCCAC TGATCAGAAC CGTTTCTTGA TTCTTATGGC GAGCCGTGCT GACGATGATC
CAACTTGCTT CCTGTTTGGT CTTGTGCAAT CTGCAGATGA TTAATCTCTT GAAGAAGCCA AGAAGTGATC AACACGCGGA
AGAAATCAAC AGCTTCTTTC ACGGCGTGCG AGCTGCATGC TGATGCTCCA GGATCGATCG ATCGATCATT GCATCTCCAA
ACTAATCACG CTTCGATCTT TCAGGACTTC ATCAATGACA GGCCGAAACC TCCTACGAGT TCTCTGATGA TATTCTTATT
TTTTTCCCAC TTCTTTTCGT TGAGCTTTTT GTAATGTTGC TTCGAGTGTT ACTCCTACAT TTTCTCCGAA ATGGCCTCAG
AATGATGCGG TCGGGCTGAT TAATTAGGTT AGACTCTTCC TGAACCAACT AGGAATAGAT TTTCTGCCTG GTTCCTGTCA
GTCCTTGTAA TATCTGCAGC AGCTTGTGAG ACAAGCGTGT TCGCTTTTGT GAACGCCCTT TTTCTTCTTT CCGATTCCTC
TGCCTGTGAT Agtactcgct ccgaaaaaaa aaaaaaaagc aaaccgtgga ttcttgggtc