Os02t0787300-01

Locus

Os02g0787300

Description

Mitogen-activated protein kinase kinase 4, Defense response, Cell proliferation, Grain growth

RAP-DB Gene Symbol Synonym(s)

SMG1, OsMKK4, MKK4, OsMKK4/SMG1

RAP-DB Gene Name Synonym(s)

SMALL GRAIN 1, MAPK kinase 4, mitogen-activated protein kinase kinase 4, small grain1

CGSNL Gene Symbol

SMG1

CGSNL Gene Name

SMALL GRAIN 1

Oryzabase Gene Symbol Synonym(s)

OsMKK4, MKK4, OsMKK4/SMG1, OsMAPKK4, MAPKK4, OsMEK4, MEK4, OsSMG1

Oryzabase Gene Name Synonym(s)

MAPK kinase 4, mitogen-activated protein kinase kinase 4, small grain1, LARGE11, large grain 11

Transcript Evidence

AK120525

Protein Evidence

Q6K4Q0

Literature

PMID: 24320692

PMID: 20525005

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

February 2, 2015

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase-like domain (IPR011009)

Protein kinase domain (IPR000719)

Serine/threonine/dual specificity protein kinase, catalytic domain (IPR002290)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase, active site (IPR008271)

Full-length cDNA

J013126P12 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0787300-01)

Others

Oryzabase (8831)

Transcript

1879 bp

>Os02t0787300-01 Mitogen-activated protein kinase kinase 4, Defense response, Cell proliferation, Grain growth
ccctgcccccgatcggcctcgtcctctccacgccgcgagcccaccagaaaacgcacacgc
cgacgcgagccaatcaacccgccgcgccgcgcctcgccgccgtcgcgatgcgaccgggcg
ggccgccgagcttgcgggcggggctgcagcagcagcagcagcagcagccgGGGACGCCGG
GGAGGTCGCGGCGCCGGCCGGATCTCACgctgccgctgccgcagcgggacctcacgtcgc
tcgcggtgccgctgccgctgccgctgccgccgtcgtcggcgccgtcgtcgacgtcgtcgt
ccgggtcgtcctcgctcggcggcgtGCCCACCCCGCCGAATTCGGTCGGCTCCGCGCCGC
CGGCCCCGCCGCCGCTGTCGGAGCTGGAGCGCGTCCGCCGCATCGGGAGCGGCGCGGGCG
GGACGGTGTGGATGGTGCGGCACCGCCCCACGGGGCGGCCGTACGCGCTCAAGGTGCTCT
ACGGGAACCACGACGACGCCGTGCGGCGGCAGATCACGCGCGAGATCGCGATCCTCCGCA
CCGCCGAGCACCCGGCCGTCGTGCGGTGCCACGGCATGTACGAGCAGGCCGGCGAGCTCC
AGATCCTGCTCGAGTACATGGACGGGGGATCCCTCGAGGGCCGCCGCATCGCCTCCGAGG
CCTTCCTCGCCGACGTCGCGCGCCAGGTGCTCTCCGGGATCGCCTACCTCCACCGCCGCC
ACATCGTCCACCGCGACATCAAGCCATCCAACCTCCTCATCGACTCCGGCCGCCGCGTCA
AGATCGCCGACTTCGGCGTCGGCCGCATCCTCAACCAGACCATGGACCCCTGCAACTCCT
CCGTCGGGACCATCGCCTACATGAGCCCCGAGCGCATCAACACCGACCTCAACGACGGCG
CCTACGACGGCTACGCCGGCGACATCTGGAGCTTCGGCCTGAGCATTCTCGAGTTCTACA
TGGGCAGGTTCCCCCTCGGGGAGAATCTCGGCAAGCAGGGAGACTGGGCCGCCCTCATGT
GCGCGATTTGCTACTCCGACTCGCCGGCGCCGCCGCCCAACGCCTCGCCGGAGTTCAAGA
GCTTCATCAGCTGCTGCCTCCAGAAGAACCCGGCGCGGCGGCCATCGGCGGCGCAGCTTC
TCCAACATCGGTTCGTCGCCGGGCCACAGCAGCAGCAGCAGCCGCAGCCGCAGCCCCTCG
CACCGCCTCCGTCATGATGAATTCCGATGGGATTCCGGCGTTGATCCGGCTCGGCCATGG
ATGGACGGTGGTTTGGCATTGAGACGTGGGATCTAGGAGTGCTCTTCCTAGCCATTTTGG
GTATTCAAGCCACCACCACAATTTAGTGATTTACCCTCATCATCATCCCCTCTCTTGTCG
CTGTTGCTCCTGGAATTAAGCTCCTCTCCTCTCCTCCCCTTCCCCTCCTCAACTTTTCTT
TAATCTCTTCTTCTTCTTTTTTTTCTTCTTCTTCTTCCAATTAAGTTCATGTTCTTCCAA
ATGATCATCATATAATATGGGTTGTTAAGAAAGCAATTTCTTCTTAATTAATTTATTTTC
TAAAATCATCATTGGAGCAGTAGAAGTAGTAGTAGTAGTAGGTGGTGGTGTCCATCTGCT
CCAGTTGCAGGAGGAGGAGGAGAAGATGGTGACAAAACAACATTGTGATGCTTTGCTGTG
CTGGCTTCTTGGATTCTGCAAATTGTGGGGGGTGGATTGGATTGGATTGGATGGATCATG
AATGGTTGGAGCAAGCAAATCTTGAAATGGGAACCAAATCAACTTTATTTTTTCCTCCTC
CTCTTCCTGAATCCTGATCCTTTCTCTCTGGTGGTTTTGAGGGGAGAATGATCGAATGAA
ATCATGAATTGCTCTCTTT

CDS

1110 bp

>Os02t0787300-01 Mitogen-activated protein kinase kinase 4, Defense response, Cell proliferation, Grain growth
atgcgaccgggcgggccgccgagcttgcgggcggggctgcagcagcagcagcagcagcag
ccgGGGACGCCGGGGAGGTCGCGGCGCCGGCCGGATCTCACgctgccgctgccgcagcgg
gacctcacgtcgctcgcggtgccgctgccgctgccgctgccgccgtcgtcggcgccgtcg
tcgacgtcgtcgtccgggtcgtcctcgctcggcggcgtGCCCACCCCGCCGAATTCGGTC
GGCTCCGCGCCGCCGGCCCCGCCGCCGCTGTCGGAGCTGGAGCGCGTCCGCCGCATCGGG
AGCGGCGCGGGCGGGACGGTGTGGATGGTGCGGCACCGCCCCACGGGGCGGCCGTACGCG
CTCAAGGTGCTCTACGGGAACCACGACGACGCCGTGCGGCGGCAGATCACGCGCGAGATC
GCGATCCTCCGCACCGCCGAGCACCCGGCCGTCGTGCGGTGCCACGGCATGTACGAGCAG
GCCGGCGAGCTCCAGATCCTGCTCGAGTACATGGACGGGGGATCCCTCGAGGGCCGCCGC
ATCGCCTCCGAGGCCTTCCTCGCCGACGTCGCGCGCCAGGTGCTCTCCGGGATCGCCTAC
CTCCACCGCCGCCACATCGTCCACCGCGACATCAAGCCATCCAACCTCCTCATCGACTCC
GGCCGCCGCGTCAAGATCGCCGACTTCGGCGTCGGCCGCATCCTCAACCAGACCATGGAC
CCCTGCAACTCCTCCGTCGGGACCATCGCCTACATGAGCCCCGAGCGCATCAACACCGAC
CTCAACGACGGCGCCTACGACGGCTACGCCGGCGACATCTGGAGCTTCGGCCTGAGCATT
CTCGAGTTCTACATGGGCAGGTTCCCCCTCGGGGAGAATCTCGGCAAGCAGGGAGACTGG
GCCGCCCTCATGTGCGCGATTTGCTACTCCGACTCGCCGGCGCCGCCGCCCAACGCCTCG
CCGGAGTTCAAGAGCTTCATCAGCTGCTGCCTCCAGAAGAACCCGGCGCGGCGGCCATCG
GCGGCGCAGCTTCTCCAACATCGGTTCGTCGCCGGGCCACAGCAGCAGCAGCAGCCGCAG
CCGCAGCCCCTCGCACCGCCTCCGTCATGA

Protein

370 aa

>Os02t0787300-01 Mitogen-activated protein kinase kinase 4, Defense response, Cell proliferation, Grain growth
MRPGGPPSLRAGLQQQQQQQPGTPGRSRRRPDLTLPLPQRDLTSLAVPLPLPLPPSSAPS
STSSSGSSSLGGVPTPPNSVGSAPPAPPPLSELERVRRIGSGAGGTVWMVRHRPTGRPYA
LKVLYGNHDDAVRRQITREIAILRTAEHPAVVRCHGMYEQAGELQILLEYMDGGSLEGRR
IASEAFLADVARQVLSGIAYLHRRHIVHRDIKPSNLLIDSGRRVKIADFGVGRILNQTMD
PCNSSVGTIAYMSPERINTDLNDGAYDGYAGDIWSFGLSILEFYMGRFPLGENLGKQGDW
AALMCAICYSDSPAPPPNASPEFKSFISCCLQKNPARRPSAAQLLQHRFVAGPQQQQQPQ
PQPLAPPPS*

5'UTR

chr02:33443842..33443948 (- strand) : 107 bp

CDS

chr02:33442732..33443841 (- strand) : 1110 bp

3'UTR

chr02:33442070..33442731 (- strand) : 662 bp

FASTA

>Os02t0787300-01 class=Sequence position=chr02:33442070..33443948 (- strand)
ccctgccccc gatcggcctc gtcctctcca cgccgcgagc ccaccagaaa acgcacacgc cgacgcgagc caatcaaccc
gccgcgccgc gcctcgccgc cgtcgcgatg cgaccgggcg ggccgccgag cttgcgggcg gggctgcagc agcagcagca
gcagcagccg GGGACGCCGG GGAGGTCGCG GCGCCGGCCG GATCTCACgc tgccgctgcc gcagcgggac ctcacgtcgc
tcgcggtgcc gctgccgctg ccgctgccgc cgtcgtcggc gccgtcgtcg acgtcgtcgt ccgggtcgtc ctcgctcggc
ggcgtGCCCA CCCCGCCGAA TTCGGTCGGC TCCGCGCCGC CGGCCCCGCC GCCGCTGTCG GAGCTGGAGC GCGTCCGCCG
CATCGGGAGC GGCGCGGGCG GGACGGTGTG GATGGTGCGG CACCGCCCCA CGGGGCGGCC GTACGCGCTC AAGGTGCTCT
ACGGGAACCA CGACGACGCC GTGCGGCGGC AGATCACGCG CGAGATCGCG ATCCTCCGCA CCGCCGAGCA CCCGGCCGTC
GTGCGGTGCC ACGGCATGTA CGAGCAGGCC GGCGAGCTCC AGATCCTGCT CGAGTACATG GACGGGGGAT CCCTCGAGGG
CCGCCGCATC GCCTCCGAGG CCTTCCTCGC CGACGTCGCG CGCCAGGTGC TCTCCGGGAT CGCCTACCTC CACCGCCGCC
ACATCGTCCA CCGCGACATC AAGCCATCCA ACCTCCTCAT CGACTCCGGC CGCCGCGTCA AGATCGCCGA CTTCGGCGTC
GGCCGCATCC TCAACCAGAC CATGGACCCC TGCAACTCCT CCGTCGGGAC CATCGCCTAC ATGAGCCCCG AGCGCATCAA
CACCGACCTC AACGACGGCG CCTACGACGG CTACGCCGGC GACATCTGGA GCTTCGGCCT GAGCATTCTC GAGTTCTACA
TGGGCAGGTT CCCCCTCGGG GAGAATCTCG GCAAGCAGGG AGACTGGGCC GCCCTCATGT GCGCGATTTG CTACTCCGAC
TCGCCGGCGC CGCCGCCCAA CGCCTCGCCG GAGTTCAAGA GCTTCATCAG CTGCTGCCTC CAGAAGAACC CGGCGCGGCG
GCCATCGGCG GCGCAGCTTC TCCAACATCG GTTCGTCGCC GGGCCACAGC AGCAGCAGCA GCCGCAGCCG CAGCCCCTCG
CACCGCCTCC GTCATGATGA ATTCCGATGG GATTCCGGCG TTGATCCGGC TCGGCCATGG ATGGACGGTG GTTTGGCATT
GAGACGTGGG ATCTAGGAGT GCTCTTCCTA GCCATTTTGG GTATTCAAGC CACCACCACA ATTTAGTGAT TTACCCTCAT
CATCATCCCC TCTCTTGTCG CTGTTGCTCC TGGAATTAAG CTCCTCTCCT CTCCTCCCCT TCCCCTCCTC AACTTTTCTT
TAATCTCTTC TTCTTCTTTT TTTTCTTCTT CTTCTTCCAA TTAAGTTCAT GTTCTTCCAA ATGATCATCA TATAATATGG
GTTGTTAAGA AAGCAATTTC TTCTTAATTA ATTTATTTTC TAAAATCATC ATTGGAGCAG TAGAAGTAGT AGTAGTAGTA
GGTGGTGGTG TCCATCTGCT CCAGTTGCAG GAGGAGGAGG AGAAGATGGT GACAAAACAA CATTGTGATG CTTTGCTGTG
CTGGCTTCTT GGATTCTGCA AATTGTGGGG GGTGGATTGG ATTGGATTGG ATGGATCATG AATGGTTGGA GCAAGCAAAT
CTTGAAATGG GAACCAAATC AACTTTATTT TTTCCTCCTC CTCTTCCTGA ATCCTGATCC TTTCTCTCTG GTGGTTTTGA
GGGGAGAATG ATCGAATGAA ATCATGAATT GCTCTCTTT