Os02t0791200-01

Locus

Os02g0791200

Description

Ankyrin domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

XBOS32

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK120632 (DDBJ, Best hit)

Protein Evidence

C7EC57 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, RING-type (IPR001841)

Ankyrin repeat (IPR002110)

Zinc finger, RING-type, conserved site (IPR017907)

Ankyrin repeat-containing domain (IPR020683)

Full-length cDNA

J013153H21 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0791200-01)

RiceXPro (AK120632)

Others

Oryzabase (11146)

KEGG (Os02t0791200-01)

Transcript

2231 bp

>Os02t0791200-01 Ankyrin domain containing protein.
GCACCCCGCGATTCCCCAATCCATCCATCCAGTCCCCCCCCTCGCTGGAATCGTGGGTGT
GGGGTGGGTTCTGAGGATTCGAGGCGGCAGGTCGCCTCCGAGGATTCCCCCTTCGAGTTC
GAGGTCCCTTGTTTTCTTGCGAGGATTGGGGGCCTGATTTAGAGGGCGTTGTCGGTCGGT
CTCGGTTTTGCATTTCTTCCAGCTCGGGACCGACGACCCTGGGCGATTCCCGAGGAGGAG
TGAGTTCCACTCTGATTTCTTGGTGTAGCGCGGAAAGTTGGCTTTTTTGGGTCGAATTGT
TGGTAGTCTCGCTGCAATTGGAAAATTTTGGGCTTTCTGAACCTTGGGGTTAAAGATCGT
CGGCATGCCTAAAGTCGGGAGCTTGATCCTGTCTGGTGATCATTCTTGAATCGAATGCGG
TTTGGGCGGCCTCGTGGATTGGGAAATTTCAGGGTGAAGTCTTCGATTCGAGGCCTTCCC
GTGCACGCTAAGAGAGGAGATCCTCAGCTTCGAGCATCCATGGGGTTCCTCAGCCTTGTG
GGCAACTCATTTGGGTGCTCGGCTTCCGGCGAGCGGCTCGTCTCGGCGGCCCGCGACGGC
GACCTGCAGGAGGCGCGCGCGCTGCTCGAGTACAACCCGCGGCTCGCCCGGTACTCCACT
TTCGGCGGCCGCAACTCGCCGCTGCACTACGCCGCCGCGCAGGGTCACCATGAGATTGTT
TCTCTGTTGCTCGAATCCGGCGTCGAGATCAACCTCAGGAATTACAGGGGCCAGACTGCT
TTAATGCAAGCCTGTCAATATGGCCACTGGGAGGTTGTTCAGACACTGATGCTTTTCAAT
GCAAATGTTCATAGGACAGATTATTTGAATGGCGGTAGTGCTCTCCATTTTGCTGCACTA
CATGGTCATGCCCGGTGCCTTCGTCTTGTGCTTGCGGATTATGTTCCCAGCATGCCAAAC
TTCTGGAACTCGATGAAGGACAGCCTATCTGAAGAAGGTCCATCTGCTGATCTTGATGAA
GATGGTTTGTTCAAGATGGTAAATCAGAAGGCGGATGGAGGACTGACTCCGCTTCATATG
GCAGCGTTAAATGGGCATGTAGAGTGTGTGCAATTGTTACTGGACTTGGGAGCATCTGTT
ATTGAGGCCACTATTGAAGATGGAACAACTATTGACTTAATAgGAGCTGGTAGCACCCCG
CTTCATTATGCTGCATGTGGTGGGAATGCTGTCTGTTGTCAACTTCTTATTGCTCGAGGA
GCTAGCCTTTCTGCACAGAATGCTAGCGGCTGGACCCCGTTGATGGTAGCTCGCTCATGG
CATAGGAACTCTCTTGAGGAAATTCTTAGCAAAGAACCAGAGAGTCGAATACGCACTGTT
CCTTCTCCATATTTGTGCCTCCCGCTTATGAGTATCATGAGCATTGCCAGGGAATTTGGC
TGGAGGTACCTAAACCAATCACCTGTATGTATTGACCCATGTGCTGTCTGCTTAGAAGGA
AGCTGCTCTGTTGCTGCAGAAGGATGCAAACATGAATTCTGCACGAGATGTGCTTTATAC
CTTTGCTCAACCAGTTACACATCAGTGAGCCCAGCAGGTGCCATACCATGCCCTCTCTGT
CGACACCCAATCATCGCTTTCACTGCGCTTCCTGGGACAAGCCCAATAAGAGAGCTCCCA
AGAAACAGTCTTTCATTGTCATTTTGCACCACATGCCCAGCTGTGAACTCCGATTCTACT
CCCTCAATCGCCAGCCATCTGTACCGGACTGAATTCCAGTGTGCACGCATGCCACCTATG
GGTTCATCCTCCTTCCGTTCCTTGAGCTGCCAGAGGTTGCCGGCGATGAAGCTTAACCCG
TCGTTTTGTATGGGTGCTATGGATACAAATCCCTGCCTAATAAGATGCTCAAGGTTCGGA
CCTAGCTTTCGTCGGTCGGCTTCCCAAGGAGAAAGTAGCAGGAGAGCATGGCCTCTAACC
TTTGATCCAATTGCTGCCACTGGTAGCTGATACCTGATATTTCCTCAGTTTTGTGCCCAT
TTTGAGGTTTACCATGTATATTCATTGGTTGCATTGGTCTGGTTTTTGCCGATGTGAGAT
GAACTTGCTGGTCCCAATTCCTTGTTGATATCAGTAGCAGCATGTAACTACTCCTTTCTC
TTGTCTGTAAATAACCTTTGTATTGCTGTGTATTGTCCGGAAATGAAGAAATGAAATGCG
GATGAGTTGAA

CDS

1596 bp

>Os02t0791200-01 Ankyrin domain containing protein.
ATGCGGTTTGGGCGGCCTCGTGGATTGGGAAATTTCAGGGTGAAGTCTTCGATTCGAGGC
CTTCCCGTGCACGCTAAGAGAGGAGATCCTCAGCTTCGAGCATCCATGGGGTTCCTCAGC
CTTGTGGGCAACTCATTTGGGTGCTCGGCTTCCGGCGAGCGGCTCGTCTCGGCGGCCCGC
GACGGCGACCTGCAGGAGGCGCGCGCGCTGCTCGAGTACAACCCGCGGCTCGCCCGGTAC
TCCACTTTCGGCGGCCGCAACTCGCCGCTGCACTACGCCGCCGCGCAGGGTCACCATGAG
ATTGTTTCTCTGTTGCTCGAATCCGGCGTCGAGATCAACCTCAGGAATTACAGGGGCCAG
ACTGCTTTAATGCAAGCCTGTCAATATGGCCACTGGGAGGTTGTTCAGACACTGATGCTT
TTCAATGCAAATGTTCATAGGACAGATTATTTGAATGGCGGTAGTGCTCTCCATTTTGCT
GCACTACATGGTCATGCCCGGTGCCTTCGTCTTGTGCTTGCGGATTATGTTCCCAGCATG
CCAAACTTCTGGAACTCGATGAAGGACAGCCTATCTGAAGAAGGTCCATCTGCTGATCTT
GATGAAGATGGTTTGTTCAAGATGGTAAATCAGAAGGCGGATGGAGGACTGACTCCGCTT
CATATGGCAGCGTTAAATGGGCATGTAGAGTGTGTGCAATTGTTACTGGACTTGGGAGCA
TCTGTTATTGAGGCCACTATTGAAGATGGAACAACTATTGACTTAATAgGAGCTGGTAGC
ACCCCGCTTCATTATGCTGCATGTGGTGGGAATGCTGTCTGTTGTCAACTTCTTATTGCT
CGAGGAGCTAGCCTTTCTGCACAGAATGCTAGCGGCTGGACCCCGTTGATGGTAGCTCGC
TCATGGCATAGGAACTCTCTTGAGGAAATTCTTAGCAAAGAACCAGAGAGTCGAATACGC
ACTGTTCCTTCTCCATATTTGTGCCTCCCGCTTATGAGTATCATGAGCATTGCCAGGGAA
TTTGGCTGGAGGTACCTAAACCAATCACCTGTATGTATTGACCCATGTGCTGTCTGCTTA
GAAGGAAGCTGCTCTGTTGCTGCAGAAGGATGCAAACATGAATTCTGCACGAGATGTGCT
TTATACCTTTGCTCAACCAGTTACACATCAGTGAGCCCAGCAGGTGCCATACCATGCCCT
CTCTGTCGACACCCAATCATCGCTTTCACTGCGCTTCCTGGGACAAGCCCAATAAGAGAG
CTCCCAAGAAACAGTCTTTCATTGTCATTTTGCACCACATGCCCAGCTGTGAACTCCGAT
TCTACTCCCTCAATCGCCAGCCATCTGTACCGGACTGAATTCCAGTGTGCACGCATGCCA
CCTATGGGTTCATCCTCCTTCCGTTCCTTGAGCTGCCAGAGGTTGCCGGCGATGAAGCTT
AACCCGTCGTTTTGTATGGGTGCTATGGATACAAATCCCTGCCTAATAAGATGCTCAAGG
TTCGGACCTAGCTTTCGTCGGTCGGCTTCCCAAGGAGAAAGTAGCAGGAGAGCATGGCCT
CTAACCTTTGATCCAATTGCTGCCACTGGTAGCTGA

Protein

532 aa

>Os02t0791200-01 Ankyrin domain containing protein.
MRFGRPRGLGNFRVKSSIRGLPVHAKRGDPQLRASMGFLSLVGNSFGCSASGERLVSAAR
DGDLQEARALLEYNPRLARYSTFGGRNSPLHYAAAQGHHEIVSLLLESGVEINLRNYRGQ
TALMQACQYGHWEVVQTLMLFNANVHRTDYLNGGSALHFAALHGHARCLRLVLADYVPSM
PNFWNSMKDSLSEEGPSADLDEDGLFKMVNQKADGGLTPLHMAALNGHVECVQLLLDLGA
SVIEATIEDGTTIDLIGAGSTPLHYAACGGNAVCCQLLIARGASLSAQNASGWTPLMVAR
SWHRNSLEEILSKEPESRIRTVPSPYLCLPLMSIMSIAREFGWRYLNQSPVCIDPCAVCL
EGSCSVAAEGCKHEFCTRCALYLCSTSYTSVSPAGAIPCPLCRHPIIAFTALPGTSPIRE
LPRNSLSLSFCTTCPAVNSDSTPSIASHLYRTEFQCARMPPMGSSSFRSLSCQRLPAMKL
NPSFCMGAMDTNPCLIRCSRFGPSFRRSASQGESSRRAWPLTFDPIAATGS*

5'UTR

chr02:33595810..33596129 (+ strand) : 320 bp

chr02:33596196..33596289 (+ strand) : 94 bp

CDS

chr02:33596290..33596589 (+ strand) : 300 bp

chr02:33596691..33596750 (+ strand) : 60 bp

chr02:33596839..33596910 (+ strand) : 72 bp

chr02:33596991..33597166 (+ strand) : 176 bp

chr02:33597256..33597416 (+ strand) : 161 bp

chr02:33597629..33597687 (+ strand) : 59 bp

chr02:33597776..33597822 (+ strand) : 47 bp

chr02:33597956..33598096 (+ strand) : 141 bp

chr02:33598345..33598436 (+ strand) : 92 bp

chr02:33598734..33599221 (+ strand) : 488 bp

3'UTR

chr02:33599222..33599442 (+ strand) : 221 bp

FASTA

>Os02t0791200-01 class=Sequence position=chr02:33595810..33599442 (+ strand)
GCACCCCGCG ATTCCCCAAT CCATCCATCC AGTCCCCCCC CTCGCTGGAA TCGTGGGTGT GGGGTGGGTT CTGAGGATTC
GAGGCGGCAG GTCGCCTCCG AGGATTCCCC CTTCGAGTTC GAGGTCCCTT GTTTTCTTGC GAGGATTGGG GGCCTGATTT
AGAGGGCGTT GTCGGTCGGT CTCGGTTTTG CATTTCTTCC AGCTCGGGAC CGACGACCCT GGGCGATTCC CGAGGAGGAG
TGAGTTCCAC TCTGATTTCT TGGTGTAGCG CGGAAAGTTG GCTTTTTTGG GTCGAATTGT TGGTAGTCTC GCTGCAATTG
GTAGGCGTCA AGCTGAAATT TCCCGTCAAT TTGCCGCTTC CCGTGATGAA TTTGACGATT TTGCAGGAAA ATTTTGGGCT
TTCTGAACCT TGGGGTTAAA GATCGTCGGC ATGCCTAAAG TCGGGAGCTT GATCCTGTCT GGTGATCATT CTTGAATCGA
ATGCGGTTTG GGCGGCCTCG TGGATTGGGA AATTTCAGGG TGAAGTCTTC GATTCGAGGC CTTCCCGTGC ACGCTAAGAG
AGGAGATCCT CAGCTTCGAG CATCCATGGG GTTCCTCAGC CTTGTGGGCA ACTCATTTGG GTGCTCGGCT TCCGGCGAGC
GGCTCGTCTC GGCGGCCCGC GACGGCGACC TGCAGGAGGC GCGCGCGCTG CTCGAGTACA ACCCGCGGCT CGCCCGGTAC
TCCACTTTCG GCGGCCGCAA CTCGCCGCTG CACTACGCCG CCGCGCAGGG TCACCATGAG GTGATGCCAT TTGTCTGCCA
AAAATGTAGC TGAAGTATCA GTGCTTCTGT ATAGATGGGT AAAAGAACTG CATTCACATT GTCTGTTGCT TGCATGTTCA
GATTGTTTCT CTGTTGCTCG AATCCGGCGT CGAGATCAAC CTCAGGAATT ACAGGGGCCA GGTAAACCAA GATTTCTGGT
ACATTTACTC GTTTAAGTTT CACTTGCGAA ATGCTATGGC AATATGCTAT AAATTTTCAT TGTATGTAGA CTGCTTTAAT
GCAAGCCTGT CAATATGGCC ACTGGGAGGT TGTTCAGACA CTGATGCTTT TCAATGCAAA TGTGAGTATT TTGCTTGCTG
TTCACTGAGA AATTTCTAGT CGCTTGGATA TCTAATCCTG AGGCATTGGA ACGTATTTTA GGTTCATAGG ACAGATTATT
TGAATGGCGG TAGTGCTCTC CATTTTGCTG CACTACATGG TCATGCCCGG TGCCTTCGTC TTGTGCTTGC GGATTATGTT
CCCAGCATGC CAAACTTCTG GAACTCGATG AAGGACAGCC TATCTGAAGA AGGTCCATCT GCTGATCTTG ATGAAGAGTA
TGTTAGAGCC CCTTGATTGT TTCCCATTGG TTTATTGGTT GTTAAACCGA CCATGAATCA TTCAAATAGT ATGTCTGTGT
TAGCAGTGGT TTGTTCAAGA TGGTAAATCA GAAGGCGGAT GGAGGACTGA CTCCGCTTCA TATGGCAGCG TTAAATGGGC
ATGTAGAGTG TGTGCAATTG TTACTGGACT TGGGAGCATC TGTTATTGAG GCCACTATTG AAGATGGAAC AACTATTGAC
TTAATAggta tttttttgca actttaactt tcctttctgt gcttggtgtt tttcaatttg ataatgttgg AGCACACTCT
TAGGGCATGT AGCGCTTAAC ATGTTTGAAT GTATCACCAA GTTGTCCATA CTATCTACAG TTCTTGATTC TTCCAGCTTT
CTACTCTGTT TATATTCTCA TATATCTAGA TGTAATATTT TGTTGCTTCC ATCTGCCAGG AGCTGGTAGC ACCCCGCTTC
ATTATGCTGC ATGTGGTGGG AATGCTGTCT GTTGTCAAGT ATGTTCTGCC AGTCTGAAGG CTTTTTCATA ATTTAAATGT
TTGTCTAGTT TTATCAACAT ATCTAACCAG AAGCTGTTTG ATGCAGCTTC TTATTGCTCG AGGAGCTAGC CTTTCTGCAC
AGAATGCTAG CGGGTATGAT TCTGAAGTTT TGATACATGG TTAAAGAGCT ATCTTTTTTC ACGGGGCATA GTGAAAGAAC
TATCACTGTT TCTGTTAATT TTAAAACCTA GTAGTTAAAA GCATATGTTT CATTTCCCTT ATGCAGCTGG ACCCCGTTGA
TGGTAGCTCG CTCATGGCAT AGGAACTCTC TTGAGGAAAT TCTTAGCAAA GAACCAGAGA GTCGAATACG CACTGTTCCT
TCTCCATATT TGTGCCTCCC GCTTATGAGT ATCATGAGCA TTGCCAGGTA AGGTTGCTGC TAAAATATCT TTACTTCCTT
TTCCGTTACA TATATGAGTA GTAGTACTAA AGTACTGGTC ATGTTTGTAA TCATTGACTT GCTTAGTTAT TAGTTTGCTA
TGACATGCTT AGACCAATTC GTTTACTCTA ATTGTGCAGC ATTGATAAGT ATTATCCTCC ATTTTTTAAA ATTTAACCAT
AGTGCAGTGC TTTTGTTGGT AACATCTGAT AGTTCCATTG CAATTTATTT TGCAGGGAAT TTGGCTGGAG GTACCTAAAC
CAATCACCTG TATGTATTGA CCCATGTGCT GTCTGCTTAG AAGGAAGCTG CTCTGTTGCT GCAGAAGGTA CACTTCCAAA
CAAACGTATT GCTTATGTGT TATTGTCGTT GAAGCTAACT GAACTTTTAG CACGAAAAGT TTCTTATATT TTAAACAAGG
GCATTAAAGT AGTACTGTCG ACTACCACAC TAGCATTAAT ATCATAGGAA GTTCGCTAAT TATTTCACCC TTTATGTTCT
GGTTCATAAG TCATAACTAG TAACTCAGCA GCTATAAAAA GTAATCCAGT GCACTTATCC TTACAGTTAA ACCAATATCA
GCAGCCGATA AACTGAACCT TTTCAACTAT GTTCGATTAT GCAGGATGCA AACATGAATT CTGCACGAGA TGTGCTTTAT
ACCTTTGCTC AACCAGTTAC ACATCAGTGA GCCCAGCAGG TGCCATACCA TGCCCTCTCT GTCGACACCC AATCATCGCT
TTCACTGCGC TTCCTGGGAC AAGCCCAATA AGAGAGCTCC CAAGAAACAG TCTTTCATTG TCATTTTGCA CCACATGCCC
AGCTGTGAAC TCCGATTCTA CTCCCTCAAT CGCCAGCCAT CTGTACCGGA CTGAATTCCA GTGTGCACGC ATGCCACCTA
TGGGTTCATC CTCCTTCCGT TCCTTGAGCT GCCAGAGGTT GCCGGCGATG AAGCTTAACC CGTCGTTTTG TATGGGTGCT
ATGGATACAA ATCCCTGCCT AATAAGATGC TCAAGGTTCG GACCTAGCTT TCGTCGGTCG GCTTCCCAAG GAGAAAGTAG
CAGGAGAGCA TGGCCTCTAA CCTTTGATCC AATTGCTGCC ACTGGTAGCT GATACCTGAT ATTTCCTCAG TTTTGTGCCC
ATTTTGAGGT TTACCATGTA TATTCATTGG TTGCATTGGT CTGGTTTTTG CCGATGTGAG ATGAACTTGC TGGTCCCAAT
TCCTTGTTGA TATCAGTAGC AGCATGTAAC TACTCCTTTC TCTTGTCTGT AAATAACCTT TGTATTGCTG TGTATTGTCC
GGAAATGAAG AAATGAAATG CGGATGAGTT GAA

Locus: Os02g0791200

Loading...

Locus: Os02g0791200

Loading...