Os02t0793900-01

Locus

Os02g0793900

Description

Ubiquitous nuclear protein, Regulation of photoperiodic flowering

RAP-DB Gene Symbol Synonym(s)

HDR1

RAP-DB Gene Name Synonym(s)

HEADING DATE REPRESSOR 1, Heading Date Repressor1, Heading Date Repressor 1

CGSNL Gene Symbol

HDR1

CGSNL Gene Name

HEADING DATE REPRESSOR 1

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Heading Date Repressor1, Heading Date Repressor 1

Transcript Evidence

AK102581

NM_001054907

Protein Evidence

Q6K678

Literature

PMID: 26954091

Note

Manual Curation

March 18, 2016

Full-length cDNA

J033098B13 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0793900-01)

RiceXPro (AK102581)

Others

Oryzabase (20952)

KEGG (Os02t0793900-01)

Transcript

1154 bp

>Os02t0793900-01 Ubiquitous nuclear protein, Regulation of photoperiodic flowering
GAAGGCACGCGAGACGGTCAAGAAACAAACGGGAGTTGCTTCCAAGGCGAAGGCGACCCG
GTGACCCACCTCTCCTCTCTCTTCTCGCCGTCCTAGCAAGTAGCAACCCTCCTCAGCCAA
GAACCACAAGATAACGCAACTCACAAGGCACGCACCCATAGATTGATAGAGAGAGGGACA
GAGAGAGAGAGAGATAGAGCTCAGGTTGCAAGCAGATAGAACGGGTCCAGGTAGCTTCGC
AATCAAGAAGAAGAAGAAGAGTGAAGGAGGAGGAGGAGCAAGAGCAAGCCATGGAGGAGC
CGGCCTCGGCTGATCCCCCGCGGATTTTCTGGAAGTCGAGGAGGAGATCAGCCTCAGCCA
ATGGCCGGAGCTTGCAACAAGAACTTAACAAAGAGGCTGCTGATGAACAACTGAACAATC
AGGCTCATGAAGAGGCCATGAAAATAGATGATGCAAATGCAGTAAGTACTGACGACGATG
TTCATCCAGATCCAAAAGCTAACTTATCTGAGAAGAGGAAGGCGCTGTTTGAGCCTTTGG
AACCAATCAACGGCAAGCGCAGTTCTGCTGAAATGTTGCTCCCACCACCAGACTTTGAGC
CCGCGTCATATCCCAAGGGATGGCTGGTTGGCAAGAAACGCAAGCTTGTGAATGTTGATG
TGGTGGAGAGCATGAGGAGGATAGCAATCCAAGAAATGAACAGAAAGGACCGTGAGATCA
ATGGCCTGAATGAACAGTTGGAAGAAGACTCCCGAGTGCTTGAGCTTCTACAAAAGCAGC
TCGCAGATGAGCGTAAGAAGCGAACGGAGATAGAGAAGGAAAATTCCATGCTTCATGAGC
AGGTATCTATGCTGATGAACATGCTCGATGAAAATGAAGCCTTTGATGAGGAGGGAGAAG
CACCACCACCTGATACCTTATAGGCTTAGATTAAGTAATATTATCAAGGTTCCAAGTTCT
ACACATCTTCGGATACCAGTTTAAGAGTATTCCCAGATGTCTTTATCTTGTGTAAAATTC
AATTTATCTTATTTTATTTTATGGCTTGTGTGTAGATGAAGGGGTTCTGTTTGCTGTACC
TATTTGTTTCTAGGCTGCAAGTGTATGCGAGATGCTTGTAATGTATTCTATTTAAATGCA
AGTGTTTACATGTT

CDS

633 bp

>Os02t0793900-01 Ubiquitous nuclear protein, Regulation of photoperiodic flowering
ATGGAGGAGCCGGCCTCGGCTGATCCCCCGCGGATTTTCTGGAAGTCGAGGAGGAGATCA
GCCTCAGCCAATGGCCGGAGCTTGCAACAAGAACTTAACAAAGAGGCTGCTGATGAACAA
CTGAACAATCAGGCTCATGAAGAGGCCATGAAAATAGATGATGCAAATGCAGTAAGTACT
GACGACGATGTTCATCCAGATCCAAAAGCTAACTTATCTGAGAAGAGGAAGGCGCTGTTT
GAGCCTTTGGAACCAATCAACGGCAAGCGCAGTTCTGCTGAAATGTTGCTCCCACCACCA
GACTTTGAGCCCGCGTCATATCCCAAGGGATGGCTGGTTGGCAAGAAACGCAAGCTTGTG
AATGTTGATGTGGTGGAGAGCATGAGGAGGATAGCAATCCAAGAAATGAACAGAAAGGAC
CGTGAGATCAATGGCCTGAATGAACAGTTGGAAGAAGACTCCCGAGTGCTTGAGCTTCTA
CAAAAGCAGCTCGCAGATGAGCGTAAGAAGCGAACGGAGATAGAGAAGGAAAATTCCATG
CTTCATGAGCAGGTATCTATGCTGATGAACATGCTCGATGAAAATGAAGCCTTTGATGAG
GAGGGAGAAGCACCACCACCTGATACCTTATAG

Protein

211 aa

>Os02t0793900-01 Ubiquitous nuclear protein, Regulation of photoperiodic flowering
MEEPASADPPRIFWKSRRRSASANGRSLQQELNKEAADEQLNNQAHEEAMKIDDANAVST
DDDVHPDPKANLSEKRKALFEPLEPINGKRSSAEMLLPPPDFEPASYPKGWLVGKKRKLV
NVDVVESMRRIAIQEMNRKDREINGLNEQLEEDSRVLELLQKQLADERKKRTEIEKENSM
LHEQVSMLMNMLDENEAFDEEGEAPPPDTL*

5'UTR

chr02:33737069..33737329 (- strand) : 261 bp

chr02:33736878..33736906 (- strand) : 29 bp

CDS

chr02:33736811..33736877 (- strand) : 67 bp

chr02:33735129..33735478 (- strand) : 350 bp

chr02:33734668..33734883 (- strand) : 216 bp

3'UTR

chr02:33734437..33734667 (- strand) : 231 bp

FASTA

>Os02t0793900-01 class=Sequence position=chr02:33734437..33737329 (- strand)
GAAGGCACGC GAGACGGTCA AGAAACAAAC GGGAGTTGCT TCCAAGGCGA AGGCGACCCG GTGACCCACC TCTCCTCTCT
CTTCTCGCCG TCCTAGCAAG TAGCAACCCT CCTCAGCCAA GAACCACAAG ATAACGCAAC TCACAAGGCA CGCACCCATA
GATTGATAGA GAGAGGGACA GAGAGAGAGA GAGATAGAGC TCAGGTTGCA AGCAGATAGA ACGGGTCCAG GTAGCTTCGC
AATCAAGAAG AAGAAGAAGA GGTGAGATTT TGATTTTGAT TTTGATTTTC TCTCTGTTTG TTTTTGCTTT GGTGTGGTTC
TTGTTTCCCC AGTCGAGAGC CTCACCCCCT CAAGAGGCTC ATGGAGGTGA GGAGAAATCA AAGGCCAAGC TGATTTTGTG
TGATTTGATT CTCTCTGCTG CAGTGAAGGA GGAGGAGGAG CAAGAGCAAG CCATGGAGGA GCCGGCCTCG GCTGATCCCC
CGCGGATTTT CTGGAAGTCG AGGAGGAGAT CAGCCTCAGG TGCTTTGTTA ATTACATGCT TCATTCAAAT GTAAATCATG
CTGATTTCGA CTCCTGCTTC TTCTTGCTCT GCTCAGATAT GAGATATCCA TTCCTTCTCT CATAATCTCT TGTTGATTAA
ATCTCGCTAG CTTCAAATTC AGTCCCTTTC GAAGCTTCTC TGCATTTTCT TTCAGTTTTA AAAAAATTGT ATGAACCATA
CAACACTTTG ATTTACGGTT TTACACCTAA TTACTGGTAA TCTTGGCTAC TTACAAGTTA GTATCCTCGA AATTTCCTGC
TGCTAAACGT ACTGTAGCTG GTAGCATGGA ATAATTTCTG AGTGAGATGT TTCGTGGGGG ATTAAATTAT TGCCAGCTCA
CTGAATCGAT ATATAATTAT TATTCCGTAC ACGTTAATCA CGCACCGGTT TGGCTGGTCC ATTTGGTGCA AGCTCATGAG
GATTAAGACT TAGAGGCGCC TTGATAACTA AACTAAGAGG ATGTGGCCTG CTTAATTTGC TTGTCTTTAC CGCCAAGATT
CTGAAACTGC ACCTGTCGGT GCTAGGTAGC TTACCAGTGC TAGTGCGAAT ATGCTTGCAG AAACAAATCA TATTCCTCTC
CGTAACTTGG TACTGCCTTG CTTTGTGGAA TGAGATTTTT TATTGGTGCA TCTGGCTGCT ACTTCTTTTG TTGCTCATGT
ATCCTCTATG ATTTCACTGC TCTTTTGGTC AACTCCCAAT TAAGTTGCAA CTGCATCTAG ATAATTTTGG TATTGACAAA
GACATAGACG AACTTGCTTG GTCGCATACA GTAATTATGG CCTCACGTGC AATAATTTTT CCCGGGGTCA GAGTGTCAGA
TTAAATAGCA TGTTGTCGAC CTTAGCAGTT AGCAGTGTTA AATAAGGTTA GGGTGTCGTT GCATGTGGCA ATATTGAACC
TTTTTTTTTT TTTGAACATG TGTTGTTGAC CAGTTAGCTT AGGCCTTAGG CCAAAGTAAA TCAATCAGTT TTTGCTCTTG
AAAATGTAAG GCTTGTCAAT GCATAGAACT TGCAGGAGAT AATTTGTTTA ATTGTGCATG TTCCAAATAG TTGCTGTTTT
TGTACCTTGA TACTTTGCTT CATCACCAAG GATGGTCTAC ATATGTCAAT ATAAATACAT TGAGAGACCG TTCGTTGGTC
TTGAGCTGAT GTATGCTAAC AAGTTATCAG GCTGTCATGA TAGCAGAACA CACTCTGAAA TTAAAGAACT TCCATATAAT
CATGTAGTTA TAATGTTCAC CTGTATGCAT TAGATTTTAG CTAGAGAAGT GCACTGACTC TTGAATCTGA CTAACAATAT
GTATGTTCCA GCCAATGGCC GGAGCTTGCA ACAAGAACTT AACAAAGAGG CTGCTGATGA ACAACTGAAC AATCAGGCTC
ATGAAGAGGC CATGAAAATA GATGATGCAA ATGCAGTAAG TACTGACGAC GATGTTCATC CAGATCCAAA AGCTAACTTA
TCTGAGAAGA GGAAGGCGCT GTTTGAGCCT TTGGAACCAA TCAACGGCAA GCGCAGTTCT GCTGAAATGT TGCTCCCACC
ACCAGACTTT GAGCCCGCGT CATATCCCAA GGGATGGCTG GTTGGCAAGA AACGCAAGCT TGTGAATGTT GATGTGGTGG
AGAGCATGAG GAGGATAGCA ATCCAAGAAA TGAACAGAAA GGTTCATGAT CTTTTTAATA GTTTGCTACC GTACCACAAT
ACCACATACT AGCACAATAT CGTGATGCAT TTGGTATACT TTTTTCCTTT TTTTTTATCG ATGATCAAGG CTTGAAAAAA
CTAACTTTAT CCTCAATTTA CGACGTGTGT TGGTCTAGTT AAACCCAAAG TTGAATTATA TGCGATTCTA TTTGTTGCTC
ACTGAAGCAT ACATTGACTC CTATATTCAT GGAAATGCTG TGGCAGGACC GTGAGATCAA TGGCCTGAAT GAACAGTTGG
AAGAAGACTC CCGAGTGCTT GAGCTTCTAC AAAAGCAGCT CGCAGATGAG CGTAAGAAGC GAACGGAGAT AGAGAAGGAA
AATTCCATGC TTCATGAGCA GGTATCTATG CTGATGAACA TGCTCGATGA AAATGAAGCC TTTGATGAGG AGGGAGAAGC
ACCACCACCT GATACCTTAT AGGCTTAGAT TAAGTAATAT TATCAAGGTT CCAAGTTCTA CACATCTTCG GATACCAGTT
TAAGAGTATT CCCAGATGTC TTTATCTTGT GTAAAATTCA ATTTATCTTA TTTTATTTTA TGGCTTGTGT GTAGATGAAG
GGGTTCTGTT TGCTGTACCT ATTTGTTTCT AGGCTGCAAG TGTATGCGAG ATGCTTGTAA TGTATTCTAT TTAAATGCAA
GTGTTTACAT GTT

Locus: Os02g0793900

Loading...

Locus: Os02g0793900

Loading...