Os02t0796300-01

Locus

Os02g0796300

Description

Component of the CCR4-NOTcomplex, Deadenylase, Deadenylation (poly(A) tail shortening), Heat stress response

RAP-DB Gene Symbol Synonym(s)

OsCAF1H, OsCAF1-1

RAP-DB Gene Name Synonym(s)

CCR4-associated factor 1H, carbon cataboliterepressor 4-associated factor 1H, CCR4-associated factor 1-1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCAF1H, CAF1H, OsCAF1-1

Oryzabase Gene Name Synonym(s)

CCR4-associated factor 1H, carbon catabolite repressor 4-associated factor 1H, CCR4-associated factor 1-1

Transcript Evidence

AK119386

Protein Evidence

Q0DWT7

Literature

PMID: 24805883

Note

Manual Curation

July 27, 2015

Gene Ontology (GO)

Molecular Function: nucleic acid binding (GO:0003676)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Ribonuclease CAF1 (IPR006941)

Ribonuclease H-like domain (IPR012337)

Full-length cDNA

001-132-B12 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0796300-01)

RiceXPro (AK119386)

Others

Oryzabase (18147)

KEGG (Os02t0796300-01)

Transcript

2885 bp

>Os02t0796300-01 Component of the CCR4-NOTcomplex, Deadenylase, Deadenylation (poly(A) tail shortening), Heat stress response
AAAAGAAAAAAAAAATCCCCATTTCTCTAAAAATCTAGAGGCTTCTTCTCTTCTCCTCTC
TCTCGTTCCCCTTCGTTTCGATTCGTCTCGCCCAAATCTTCAAATCCAAATCCGCAGCGG
AGGCGGCCGGGGCGCGGCGGCCAGATCCTGGAAGAGAATCCATTCCGGGAGGGGAATCCG
CGCATGCCAATGTCGGATCCCACGGCGGCGGTCATCCCCAAGCCGGGGGGCATCGGCGTC
GGCGGCGGAGGCGGCGACGACGAGGAGCCGGTGGAGATCCGGGAGGTGTGGGCGGACAAC
CTCGAGGAGGAGTTCGCGCTGATCCGCGACGTCGTCGACGAGTTCCCCTTCGTCGCCATG
GACACGGAGTTCCCTGGCATCGTGTGCCGCCCCGTCGGCGCCTTCCGCTCCCCGGCCGAC
TACAACTACGCCACGCTCAAGGCCAACGTCGACATGCTCCACCTCATCCAGCTCGGCCTC
ACCTTCTCCAGCCCGCGCGGCGAGCTCCCCGCGCTCGGCCCAGGCCGCCGCCGATGCGTA
TGGCAGTTTAATTTCCGCGAGTTCGACGACGCCCGCGACATCTTCGCCTCTGACTCCATT
GAGCTCCTGCGCCGTAGCGGCATCGACTTCCGCCGCAACTCCGAGCGCGGCGTTGACGCT
CGCCGGTTCGCGGAGCTGCTCATGTCCTCTGGCGTCGTGCTTAACGATTCTGTATATTGG
GTCACCTTCCACGCGGGCTACGACTTCGGGTACCTGCTTAAGATCCTCACATGCAGCAGC
CTACCGGACACGCAAGCCGGCTTCTTTAAGCTCATGAAGATATATTTCCCCACCGTGTAT
GACATCAAGCACCTCATGAAGTTCTGCAATAGCCTGCACGGTGGGCTGAACAAGCTCGCC
GAGCTCCTTGACGTGGAGCGCGTCGGAGAGTCCCACCAGGCCGGTTCAGATAGCTTGGTC
ACTTCATGCGCGTTCTGGAAGCTCAAGGATTCGTTCTTCGCTGGCTCTACCGAGAAATAT
GCTGGAGTGCTGTATGGGCTCAATGCGGAGAATGTTGTCAGTGCGCATTGATGGATGGTA
CTCCTCTTTGAATTTTAGCTTTGTGAATGGATTGATTTAGGACAGAAAATGTGACAAATG
ATCAAGATGATGTTATGTAGGTCAAGTTTGTCTCACTCCATTTGGGTTTAATGTGATCCT
AGTGTTCTTCAGTTATTCGCGATGAAATAGTGAACTGTATTTATGTTAAGTTGTTCTGTC
CGCTTTCATTTTCTCCTACCTGGTTTAGTTAGATAGGAAAGAAAAATCACCTTTAAGGAT
TAGGAGATGGTAAAATGAATATATTTTGTTGCTGTTTTGTCATTGATATGTATAGCATGG
AAGCTGGTTGTTTCCAAAGAGTGGGGTGCGGGTACATCAAAGTGCTCAAACATGTAACTT
GATAACATTACAATACAATACACAGAGCGCGACCTCTCTTCACATGGGTATTTTAGATGC
TGTTATTTTAATTTCCCAGAATAATTAGTTACTCTAATATGTATCCTTCTAGAGAATAAC
ACAATGCAATATTGAGAATAAGGGCATCTCTCTATTTCGACTTTGTGCTGCAGTTTTTGG
TAATCTGAGGTAATGCTATCTGGTCTACATTGGAAGCCTGGAAACATTTACGGTTTTCAG
CCAAAGTTTTCTACTATTTGTTCATCAATTCAATTATCCAGTAAGCCTACTGCCTAGCGA
ATAGTTCTGGGCTTCTGGCCAATGTTCACTAGGCAAAACCTCTGTACTCCATGGAGTAAA
ACTACAGTGAAATCCTGCAAATATGCAAATTCTGCAGATTTGCTAACAAAATATTAGATA
CGCATCTAGCTATATGTGTCTCTTGATCCAGCAATTAAGTCACAATGATGCACAGAGCAT
GAATACTAGCAGTTTACTTTTTCCATAATAGGTTGTGGGTTACAGTAACAAATATGCATG
TCTTGAGACAGTGATGCTGATACTATTTCCCTTGCCTTCCTGCAACACTTGGATTGAATT
TCTACTTATCCAACTTATATTCTAGATACAACATTGATCCATTTACATTCTTTGTGAAAA
ACTTATCATAACTAGATGAGCTTTGACCACAAGTTACATCATTCCCTGCAATTTAATAGC
ATCAGATTATTTCATTGCTGGATGTACCGGACCACTCTTTTTTGCTTTGCAACTAGAATA
TTAGTTCCTTTGGCACTAACATGTCCTCAAATGTTGCATGTGGAGATGAAATCTAGGGCA
TTTAATTAAGTTACTAACGAGTTTATTTACAGGTTCTGTTGGAACCCAATTTAGAGAAGA
ATCTAGTTAGCTACATCTTCTCGTTTTATTAAGACTCAACTTGGACACTACCTTAATCCC
GGTTGATTGCCATTGTCCAGTTTATTTAAATTCATGTATATAATCGGTCCTTCTTAAGTT
CGGACATTGTTGGAGAGCTATTCTGAATAAAGGTAATGGTGGCTAACAAGAAACAAGGTA
AGGATTGTTAGAAACTGGAGAAGTTTGGGTGCCAAAAAGCTTCAAAAGTATTGAAATTGT
CTAATGTTTCATATTTTGCAGGTAAACCTGATAATACTTTCCTAGTGTATCATTTTTTAA
CGGGATGCATTTCTGGTGTTAAAATGTGGTACTCGTCATGCCAACTTGTGCATGGGTTCA
ATTTGAAGACTGAGAAGCCTTGTGCACGCATGAACTTTCTTCATCACAGATTGATGGCAG
CAGCAGCCTATCTCAATTCCCCAAATCTCCAGGGATGAGATCAAACCATCTGCATTGCAC
AAGCTTCCTCCCATGGATAATGCAAATGTGTAATGCTTATGCAATTGTAATGTGTAGTGT
TAAAC

CDS

888 bp

>Os02t0796300-01 Component of the CCR4-NOTcomplex, Deadenylase, Deadenylation (poly(A) tail shortening), Heat stress response
ATGCCAATGTCGGATCCCACGGCGGCGGTCATCCCCAAGCCGGGGGGCATCGGCGTCGGC
GGCGGAGGCGGCGACGACGAGGAGCCGGTGGAGATCCGGGAGGTGTGGGCGGACAACCTC
GAGGAGGAGTTCGCGCTGATCCGCGACGTCGTCGACGAGTTCCCCTTCGTCGCCATGGAC
ACGGAGTTCCCTGGCATCGTGTGCCGCCCCGTCGGCGCCTTCCGCTCCCCGGCCGACTAC
AACTACGCCACGCTCAAGGCCAACGTCGACATGCTCCACCTCATCCAGCTCGGCCTCACC
TTCTCCAGCCCGCGCGGCGAGCTCCCCGCGCTCGGCCCAGGCCGCCGCCGATGCGTATGG
CAGTTTAATTTCCGCGAGTTCGACGACGCCCGCGACATCTTCGCCTCTGACTCCATTGAG
CTCCTGCGCCGTAGCGGCATCGACTTCCGCCGCAACTCCGAGCGCGGCGTTGACGCTCGC
CGGTTCGCGGAGCTGCTCATGTCCTCTGGCGTCGTGCTTAACGATTCTGTATATTGGGTC
ACCTTCCACGCGGGCTACGACTTCGGGTACCTGCTTAAGATCCTCACATGCAGCAGCCTA
CCGGACACGCAAGCCGGCTTCTTTAAGCTCATGAAGATATATTTCCCCACCGTGTATGAC
ATCAAGCACCTCATGAAGTTCTGCAATAGCCTGCACGGTGGGCTGAACAAGCTCGCCGAG
CTCCTTGACGTGGAGCGCGTCGGAGAGTCCCACCAGGCCGGTTCAGATAGCTTGGTCACT
TCATGCGCGTTCTGGAAGCTCAAGGATTCGTTCTTCGCTGGCTCTACCGAGAAATATGCT
GGAGTGCTGTATGGGCTCAATGCGGAGAATGTTGTCAGTGCGCATTGA

Protein

296 aa

>Os02t0796300-01 Component of the CCR4-NOTcomplex, Deadenylase, Deadenylation (poly(A) tail shortening), Heat stress response
MPMSDPTAAVIPKPGGIGVGGGGGDDEEPVEIREVWADNLEEEFALIRDVVDEFPFVAMD
TEFPGIVCRPVGAFRSPADYNYATLKANVDMLHLIQLGLTFSSPRGELPALGPGRRRCVW
QFNFREFDDARDIFASDSIELLRRSGIDFRRNSERGVDARRFAELLMSSGVVLNDSVYWV
TFHAGYDFGYLLKILTCSSLPDTQAGFFKLMKIYFPTVYDIKHLMKFCNSLHGGLNKLAE
LLDVERVGESHQAGSDSLVTSCAFWKLKDSFFAGSTEKYAGVLYGLNAENVVSAH*

5'UTR

chr02:33854163..33854345 (+ strand) : 183 bp

CDS

chr02:33854346..33855233 (+ strand) : 888 bp

3'UTR

chr02:33855234..33857047 (+ strand) : 1814 bp

FASTA

>Os02t0796300-01 class=Sequence position=chr02:33854163..33857047 (+ strand)
AAAAGAAAAA AAAAATCCCC ATTTCTCTAA AAATCTAGAG GCTTCTTCTC TTCTCCTCTC TCTCGTTCCC CTTCGTTTCG
ATTCGTCTCG CCCAAATCTT CAAATCCAAA TCCGCAGCGG AGGCGGCCGG GGCGCGGCGG CCAGATCCTG GAAGAGAATC
CATTCCGGGA GGGGAATCCG CGCATGCCAA TGTCGGATCC CACGGCGGCG GTCATCCCCA AGCCGGGGGG CATCGGCGTC
GGCGGCGGAG GCGGCGACGA CGAGGAGCCG GTGGAGATCC GGGAGGTGTG GGCGGACAAC CTCGAGGAGG AGTTCGCGCT
GATCCGCGAC GTCGTCGACG AGTTCCCCTT CGTCGCCATG GACACGGAGT TCCCTGGCAT CGTGTGCCGC CCCGTCGGCG
CCTTCCGCTC CCCGGCCGAC TACAACTACG CCACGCTCAA GGCCAACGTC GACATGCTCC ACCTCATCCA GCTCGGCCTC
ACCTTCTCCA GCCCGCGCGG CGAGCTCCCC GCGCTCGGCC CAGGCCGCCG CCGATGCGTA TGGCAGTTTA ATTTCCGCGA
GTTCGACGAC GCCCGCGACA TCTTCGCCTC TGACTCCATT GAGCTCCTGC GCCGTAGCGG CATCGACTTC CGCCGCAACT
CCGAGCGCGG CGTTGACGCT CGCCGGTTCG CGGAGCTGCT CATGTCCTCT GGCGTCGTGC TTAACGATTC TGTATATTGG
GTCACCTTCC ACGCGGGCTA CGACTTCGGG TACCTGCTTA AGATCCTCAC ATGCAGCAGC CTACCGGACA CGCAAGCCGG
CTTCTTTAAG CTCATGAAGA TATATTTCCC CACCGTGTAT GACATCAAGC ACCTCATGAA GTTCTGCAAT AGCCTGCACG
GTGGGCTGAA CAAGCTCGCC GAGCTCCTTG ACGTGGAGCG CGTCGGAGAG TCCCACCAGG CCGGTTCAGA TAGCTTGGTC
ACTTCATGCG CGTTCTGGAA GCTCAAGGAT TCGTTCTTCG CTGGCTCTAC CGAGAAATAT GCTGGAGTGC TGTATGGGCT
CAATGCGGAG AATGTTGTCA GTGCGCATTG ATGGATGGTA CTCCTCTTTG AATTTTAGCT TTGTGAATGG ATTGATTTAG
GACAGAAAAT GTGACAAATG ATCAAGATGA TGTTATGTAG GTCAAGTTTG TCTCACTCCA TTTGGGTTTA ATGTGATCCT
AGTGTTCTTC AGTTATTCGC GATGAAATAG TGAACTGTAT TTATGTTAAG TTGTTCTGTC CGCTTTCATT TTCTCCTACC
TGGTTTAGTT AGATAGGAAA GAAAAATCAC CTTTAAGGAT TAGGAGATGG TAAAATGAAT ATATTTTGTT GCTGTTTTGT
CATTGATATG TATAGCATGG AAGCTGGTTG TTTCCAAAGA GTGGGGTGCG GGTACATCAA AGTGCTCAAA CATGTAACTT
GATAACATTA CAATACAATA CACAGAGCGC GACCTCTCTT CACATGGGTA TTTTAGATGC TGTTATTTTA ATTTCCCAGA
ATAATTAGTT ACTCTAATAT GTATCCTTCT AGAGAATAAC ACAATGCAAT ATTGAGAATA AGGGCATCTC TCTATTTCGA
CTTTGTGCTG CAGTTTTTGG TAATCTGAGG TAATGCTATC TGGTCTACAT TGGAAGCCTG GAAACATTTA CGGTTTTCAG
CCAAAGTTTT CTACTATTTG TTCATCAATT CAATTATCCA GTAAGCCTAC TGCCTAGCGA ATAGTTCTGG GCTTCTGGCC
AATGTTCACT AGGCAAAACC TCTGTACTCC ATGGAGTAAA ACTACAGTGA AATCCTGCAA ATATGCAAAT TCTGCAGATT
TGCTAACAAA ATATTAGATA CGCATCTAGC TATATGTGTC TCTTGATCCA GCAATTAAGT CACAATGATG CACAGAGCAT
GAATACTAGC AGTTTACTTT TTCCATAATA GGTTGTGGGT TACAGTAACA AATATGCATG TCTTGAGACA GTGATGCTGA
TACTATTTCC CTTGCCTTCC TGCAACACTT GGATTGAATT TCTACTTATC CAACTTATAT TCTAGATACA ACATTGATCC
ATTTACATTC TTTGTGAAAA ACTTATCATA ACTAGATGAG CTTTGACCAC AAGTTACATC ATTCCCTGCA ATTTAATAGC
ATCAGATTAT TTCATTGCTG GATGTACCGG ACCACTCTTT TTTGCTTTGC AACTAGAATA TTAGTTCCTT TGGCACTAAC
ATGTCCTCAA ATGTTGCATG TGGAGATGAA ATCTAGGGCA TTTAATTAAG TTACTAACGA GTTTATTTAC AGGTTCTGTT
GGAACCCAAT TTAGAGAAGA ATCTAGTTAG CTACATCTTC TCGTTTTATT AAGACTCAAC TTGGACACTA CCTTAATCCC
GGTTGATTGC CATTGTCCAG TTTATTTAAA TTCATGTATA TAATCGGTCC TTCTTAAGTT CGGACATTGT TGGAGAGCTA
TTCTGAATAA AGGTAATGGT GGCTAACAAG AAACAAGGTA AGGATTGTTA GAAACTGGAG AAGTTTGGGT GCCAAAAAGC
TTCAAAAGTA TTGAAATTGT CTAATGTTTC ATATTTTGCA GGTAAACCTG ATAATACTTT CCTAGTGTAT CATTTTTTAA
CGGGATGCAT TTCTGGTGTT AAAATGTGGT ACTCGTCATG CCAACTTGTG CATGGGTTCA ATTTGAAGAC TGAGAAGCCT
TGTGCACGCA TGAACTTTCT TCATCACAGA TTGATGGCAG CAGCAGCCTA TCTCAATTCC CCAAATCTCC AGGGATGAGA
TCAAACCATC TGCATTGCAC AAGCTTCCTC CCATGGATAA TGCAAATGTG TAATGCTTAT GCAATTGTAA TGTGTAGTGT
TAAAC

Locus: Os02g0796300

Loading...

Locus: Os02g0796300

Loading...