Os02t0796300-02

Locus

Os02g0796300

Description

Similar to CCR4-NOT transcription complex subunit 7 (CCR4-associated factor 1) (CAF1) (BTG1 binding factor 1).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCAF1H, CAF1H, OsCAF1-1

Oryzabase Gene Name Synonym(s)

CCR4-associated factor 1H, carbon catabolite repressor 4-associated factor 1H, CCR4-associated factor 1-1

Transcript Evidence

AK073025 (DDBJ, Best hit)

AK061820 (DDBJ, Best hit)

Protein Evidence

NP_001148663.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: nucleus (GO:0005634)

Molecular Function: nucleic acid binding (GO:0003676)

Functional domain (InterPro)

Ribonuclease CAF1 (IPR006941)

Ribonuclease H-like (IPR012337)

Full-length cDNA

J023149N08 (Online Clone Ordering)

001-040-B10 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0796300-02)

RiceXPro (AK073025)

Others

Oryzabase (18147)

KEGG (Os02t0796300-02)

Transcript

1414 bp

>Os02t0796300-02 Similar to CCR4-NOT transcription complex subunit 7 (CCR4-associated factor 1) (CAF1) (BTG1 binding factor 1).
GTTTCGATTCGTCTCGCCCAAATCTTCAAATCCAAATCCGCAGCGGAGGCGGCCGGGGCG
CGGCGGCCAGATCCTGGAAGAGAATCCATTCCGGGAGGGGAATCCGCGCATGCCAATGTC
GGATCCCACGGCGGCGGTCATCCCCAAGCCGGGGGGCATCGGCGTCGGCGGCGGAGGCGG
CGACGACGAGGAGCCGGTGGAGATCCGGGAGGTGTGGGCGGACAACCTCGAGGAGGAGTT
CGCGCTGATCCGCGACGTCGTCGACGAGTTCCCCTTCGTCGCCATGGACACGGAGTTCCC
TGGCATCGTGTGCCGCCCCGTCGGCGCCTTCCGCTCCCCGGCCGACTACAACTACGCCAC
GCTCAAGGCCAACGTCGACATGCTCCACCTCATCCAGCTCGGCCTCACCTTCTCCAGCCC
GCGCGGCGAGCTCCCCGCGCTCGGCCCAGGCCGCCGCCGATGCGTATGGCAGTTTAATTT
CCGCGAGTTCGACGACGCCCGCGACATCTTCGCCTCTGACTCCATTGAGCTCCTGCGCCG
TAGCGGCATCGACTTCCGCCGCAACTCCGAGCGCGGCGTTGACGCTCGCCGGTTCGCGGA
GCTGCTCATGTCCTCTGGCGTCGTGCTTAACGATTCTGTATATTGGGTCACCTTCCACGC
GGGCTACGACTTCGGGTACCTGCTTAAGATCCTCACATGCAGCAGCCTACCGGACACGCA
AGCCGGCTTCTTTAAGCTCATGAAGATATATTTCCCCACCGTGTATGACATCAAGCACCT
CATGAAGTTCTGCAATAGCCTGCACGGTGGGCTGAACAAGCTCGCCGAGCTCCTTGACGT
GGAGCGCGTCGGAGAGTCCCACCAGGCCGGTTCAGATAGCTTGGTCACTTCATGCGCGTT
CTGGAAGCTCAAGGATTCGTTCTTCGCTGGCTCTACCGAGAAATATGCTGGAGTGCTGTA
TGGGCTCAATGCGGAGAATGTTGTCAGTGCGCATTGATGGATGGTACTCCTCTTTGAATT
TTAGCTTTGTGAATGGATTGATTTAGGACAGAAAATGTGACAAATGATCAAGATGATGTT
ATGTAGGTCAAGTTTGTCTCACTCCATTTGGGTTTAATGTGATCCTAGTGTTCTTCAGTT
ATTCGCGATGAAATAGTGAACTGTATTTATGTTAAGTTGTTCTGTCCGCTTTCATTTTCT
CCTACCTGGTTTAGTTAGATAGGAAAGAAAAATCACCTTTAAGGATTAGGAGATGGTAAA
ATGAATATATTTTGTTGCTGTTTTGTCATTGATATGTATAGCATGGAAGCTGGTTGTTTC
CAAAGAGTGGGGTGCGGGTACATCAAAGTGCTCAAACATGTAACTTGATAACATTACAAT
ACAATACACAGAGCGCGACCTCTCTTCACATGGG

CDS

888 bp

>Os02t0796300-02 Similar to CCR4-NOT transcription complex subunit 7 (CCR4-associated factor 1) (CAF1) (BTG1 binding factor 1).
ATGCCAATGTCGGATCCCACGGCGGCGGTCATCCCCAAGCCGGGGGGCATCGGCGTCGGC
GGCGGAGGCGGCGACGACGAGGAGCCGGTGGAGATCCGGGAGGTGTGGGCGGACAACCTC
GAGGAGGAGTTCGCGCTGATCCGCGACGTCGTCGACGAGTTCCCCTTCGTCGCCATGGAC
ACGGAGTTCCCTGGCATCGTGTGCCGCCCCGTCGGCGCCTTCCGCTCCCCGGCCGACTAC
AACTACGCCACGCTCAAGGCCAACGTCGACATGCTCCACCTCATCCAGCTCGGCCTCACC
TTCTCCAGCCCGCGCGGCGAGCTCCCCGCGCTCGGCCCAGGCCGCCGCCGATGCGTATGG
CAGTTTAATTTCCGCGAGTTCGACGACGCCCGCGACATCTTCGCCTCTGACTCCATTGAG
CTCCTGCGCCGTAGCGGCATCGACTTCCGCCGCAACTCCGAGCGCGGCGTTGACGCTCGC
CGGTTCGCGGAGCTGCTCATGTCCTCTGGCGTCGTGCTTAACGATTCTGTATATTGGGTC
ACCTTCCACGCGGGCTACGACTTCGGGTACCTGCTTAAGATCCTCACATGCAGCAGCCTA
CCGGACACGCAAGCCGGCTTCTTTAAGCTCATGAAGATATATTTCCCCACCGTGTATGAC
ATCAAGCACCTCATGAAGTTCTGCAATAGCCTGCACGGTGGGCTGAACAAGCTCGCCGAG
CTCCTTGACGTGGAGCGCGTCGGAGAGTCCCACCAGGCCGGTTCAGATAGCTTGGTCACT
TCATGCGCGTTCTGGAAGCTCAAGGATTCGTTCTTCGCTGGCTCTACCGAGAAATATGCT
GGAGTGCTGTATGGGCTCAATGCGGAGAATGTTGTCAGTGCGCATTGA

Protein

296 aa

>Os02t0796300-02 Similar to CCR4-NOT transcription complex subunit 7 (CCR4-associated factor 1) (CAF1) (BTG1 binding factor 1).
MPMSDPTAAVIPKPGGIGVGGGGGDDEEPVEIREVWADNLEEEFALIRDVVDEFPFVAMD
TEFPGIVCRPVGAFRSPADYNYATLKANVDMLHLIQLGLTFSSPRGELPALGPGRRRCVW
QFNFREFDDARDIFASDSIELLRRSGIDFRRNSERGVDARRFAELLMSSGVVLNDSVYWV
TFHAGYDFGYLLKILTCSSLPDTQAGFFKLMKIYFPTVYDIKHLMKFCNSLHGGLNKLAE
LLDVERVGESHQAGSDSLVTSCAFWKLKDSFFAGSTEKYAGVLYGLNAENVVSAH*

5'UTR

chr02:33854237..33854345 (+ strand) : 109 bp

CDS

chr02:33854346..33855233 (+ strand) : 888 bp

3'UTR

chr02:33855234..33855650 (+ strand) : 417 bp

FASTA

>Os02t0796300-02 class=Sequence position=chr02:33854237..33855650 (+ strand)
GTTTCGATTC GTCTCGCCCA AATCTTCAAA TCCAAATCCG CAGCGGAGGC GGCCGGGGCG CGGCGGCCAG ATCCTGGAAG
AGAATCCATT CCGGGAGGGG AATCCGCGCA TGCCAATGTC GGATCCCACG GCGGCGGTCA TCCCCAAGCC GGGGGGCATC
GGCGTCGGCG GCGGAGGCGG CGACGACGAG GAGCCGGTGG AGATCCGGGA GGTGTGGGCG GACAACCTCG AGGAGGAGTT
CGCGCTGATC CGCGACGTCG TCGACGAGTT CCCCTTCGTC GCCATGGACA CGGAGTTCCC TGGCATCGTG TGCCGCCCCG
TCGGCGCCTT CCGCTCCCCG GCCGACTACA ACTACGCCAC GCTCAAGGCC AACGTCGACA TGCTCCACCT CATCCAGCTC
GGCCTCACCT TCTCCAGCCC GCGCGGCGAG CTCCCCGCGC TCGGCCCAGG CCGCCGCCGA TGCGTATGGC AGTTTAATTT
CCGCGAGTTC GACGACGCCC GCGACATCTT CGCCTCTGAC TCCATTGAGC TCCTGCGCCG TAGCGGCATC GACTTCCGCC
GCAACTCCGA GCGCGGCGTT GACGCTCGCC GGTTCGCGGA GCTGCTCATG TCCTCTGGCG TCGTGCTTAA CGATTCTGTA
TATTGGGTCA CCTTCCACGC GGGCTACGAC TTCGGGTACC TGCTTAAGAT CCTCACATGC AGCAGCCTAC CGGACACGCA
AGCCGGCTTC TTTAAGCTCA TGAAGATATA TTTCCCCACC GTGTATGACA TCAAGCACCT CATGAAGTTC TGCAATAGCC
TGCACGGTGG GCTGAACAAG CTCGCCGAGC TCCTTGACGT GGAGCGCGTC GGAGAGTCCC ACCAGGCCGG TTCAGATAGC
TTGGTCACTT CATGCGCGTT CTGGAAGCTC AAGGATTCGT TCTTCGCTGG CTCTACCGAG AAATATGCTG GAGTGCTGTA
TGGGCTCAAT GCGGAGAATG TTGTCAGTGC GCATTGATGG ATGGTACTCC TCTTTGAATT TTAGCTTTGT GAATGGATTG
ATTTAGGACA GAAAATGTGA CAAATGATCA AGATGATGTT ATGTAGGTCA AGTTTGTCTC ACTCCATTTG GGTTTAATGT
GATCCTAGTG TTCTTCAGTT ATTCGCGATG AAATAGTGAA CTGTATTTAT GTTAAGTTGT TCTGTCCGCT TTCATTTTCT
CCTACCTGGT TTAGTTAGAT AGGAAAGAAA AATCACCTTT AAGGATTAGG AGATGGTAAA ATGAATATAT TTTGTTGCTG
TTTTGTCATT GATATGTATA GCATGGAAGC TGGTTGTTTC CAAAGAGTGG GGTGCGGGTA CATCAAAGTG CTCAAACATG
TAACTTGATA ACATTACAAT ACAATACACA GAGCGCGACC TCTCTTCACA TGGG

Locus: Os02g0796300

Loading...

Locus: Os02g0796300

Loading...