Os02t0797200-01

Locus

Os02g0797200

Description

Similar to 60S ribosomal protein L39.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Ribosomal protein L39

Transcript Evidence

AK243036 (DDBJ, Best hit)

AK120800 (DDBJ, Best hit)

Protein Evidence

NP_001105473.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: translation (GO:0006412)

Cellular Component: intracellular (GO:0005622)

Cellular Component: ribosome (GO:0005840)

Molecular Function: structural constituent of ribosome (GO:0003735)

Functional domain (InterPro)

Ribosomal protein L39e (IPR000077)

Ribosomal protein L39e, conserved site (IPR020083)

Ribosomal protein L39e domain (IPR023626)

Full-length cDNA

J100007H02 (Online Clone Ordering)

J023012L04 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0797200-01)

Others

Oryzabase (17752)

Transcript

451 bp

>Os02t0797200-01 Similar to 60S ribosomal protein L39.
ACACTTCACGCACCTAGGGTTTCGCCGCCGCCGCCGCCGCTTCTTCGTCCCCGCCGCGAC
GATGCCGTCCCACAAGACCTTCCGCATCAAGAAGAAGCTGGCGAAGAAGATGCGCCAGAA
CCGCCCCATCCCCTACTGGATCCGCATGCGGACCGACAACACCATCAGGTACAACGCGAA
GCGCAGGCACTGGCGCCGCACCAAGCTTGGGTTCTGAGCAGGAGGTAGCACCGGTTGCTG
CCTGCGGAGGCTAGGGTTACTGAGTTATCTGCATCATTTTGTTTTATGGATGTTTCAGTG
TTTATGCAAGCTTAGGATGTGATTCCAGGATGCTTTTTATTAAGGTTTTCTGAAATGTTA
AGTGTAGTTGTACTCTGGTTTACTGAGGATACCATGCTATGCTGTGCTGAGTAAAGGAAC
CATTCCAATATATGTCTTTTGAAGTTATTTC

CDS

156 bp

>Os02t0797200-01 Similar to 60S ribosomal protein L39.
ATGCCGTCCCACAAGACCTTCCGCATCAAGAAGAAGCTGGCGAAGAAGATGCGCCAGAAC
CGCCCCATCCCCTACTGGATCCGCATGCGGACCGACAACACCATCAGGTACAACGCGAAG
CGCAGGCACTGGCGCCGCACCAAGCTTGGGTTCTGA

Protein

52 aa

>Os02t0797200-01 Similar to 60S ribosomal protein L39.
MPSHKTFRIKKKLAKKMRQNRPIPYWIRMRTDNTIRYNAKRRHWRRTKLGF*

5'UTR

chr02:33928348..33928408 (+ strand) : 61 bp

CDS

chr02:33928409..33928411 (+ strand) : 3 bp

chr02:33928513..33928616 (+ strand) : 104 bp

chr02:33928713..33928761 (+ strand) : 49 bp

3'UTR

chr02:33928762..33928995 (+ strand) : 234 bp

FASTA

>Os02t0797200-01 class=Sequence position=chr02:33928348..33928995 (+ strand)
ACACTTCACG CACCTAGGGT TTCGCCGCCG CCGCCGCCGC TTCTTCGTCC CCGCCGCGAC GATGGTACGC TCCTCGATCT
CGCGCTCTTC TCTCGTCGAA TCCATTCCGG CCGACCGACC GACGTTTCGT TGATGTGATT GCTTGCTTGT TTCGTTTCGC
CGCAGCCGTC CCACAAGACC TTCCGCATCA AGAAGAAGCT GGCGAAGAAG ATGCGCCAGA ACCGCCCCAT CCCCTACTGG
ATCCGCATGC GGACCGACAA CACCATCAGG TGATTTATTC TTCGCGCTCA GTCTTTGCTC CTCCCGAGTT CGATTCGGCT
TAGGCATATC CGCTGAGATG TCGTGGTTTG GTTTGTGTTG TTCAGGTACA ACGCGAAGCG CAGGCACTGG CGCCGCACCA
AGCTTGGGTT CTGAGCAGGA GGTAGCACCG GTTGCTGCCT GCGGAGGCTA GGGTTACTGA GTTATCTGCA TCATTTTGTT
TTATGGATGT TTCAGTGTTT ATGCAAGCTT AGGATGTGAT TCCAGGATGC TTTTTATTAA GGTTTTCTGA AATGTTAAGT
GTAGTTGTAC TCTGGTTTAC TGAGGATACC ATGCTATGCT GTGCTGAGTA AAGGAACCAT TCCAATATAT GTCTTTTGAA
GTTATTTC