Os02t0797400-01

Locus

Os02g0797400

Description

MCM family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

MCM5

CGSNL Gene Name

MINI-CHROMOSOME MAINTENANCE PROTEIN 5

Oryzabase Gene Symbol Synonym(s)

OsMCM5

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK073980 (DDBJ, Best hit)

Protein Evidence

B3GNI3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: DNA replication (GO:0006260)

Biological Process: DNA-dependent DNA replication initiation (GO:0006270)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Mini-chromosome maintenance, DNA-dependent ATPase (IPR001208)

Mini-chromosome maintenance complex protein 5 (IPR008048)

Nucleic acid-binding, OB-fold (IPR012340)

Nucleic acid-binding, OB-fold-like (IPR016027)

Mini-chromosome maintenance, conserved site (IPR018525)

Full-length cDNA

J033076G02 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0797400-01)

RiceXPro (AK073980)

Others

Oryzabase (9199)

KEGG (Os02t0797400-01)

Transcript

2596 bp

>Os02t0797400-01 MCM family protein.
GTCTTCCCCCCTTTCCCCGCCGCCCGCGCACCCACGCGTCTCTCTCCCTCTCTCTCCGCC
GCCGCCGCCGCCGCAGCCAGCCAGCCATCCAGCCATGTCGGGTTGGGACGAGGGCGCCGT
CTTCTACAGCGACCAGGCGCAGTTCCCGCGCGGCGGCCCCGGCGGCGACCCCTCCGCCGA
CCTCACCCGCCACTCCGCCCTCCGCAAGTTCAAGGAGTTCCTCCGCGGCTTCACCGGCCC
AACCGGCGACTTCCCCTACCGCGAGAGCCTGGTGCACAACCGCGACCATGTCACCGTCGC
CATCGAGGACCTCGACGCCTTCGACGCCGAGCTGTCCGACAAGATCCGGAAGTCTCCCGC
TGATTACCTACCGCTGTTTGAGACGGCTGCGTCCGAGGTCCTCGCGAGCCTTCGGTCCAA
GGTCGCTGGAGAGACCGGCGAGATGGAGGAGCCCGCCACCGGCGACGTGCAGATCTTCTT
GTCCTCAAAGGAGAACTGCCTGTCCATGAGGTCTATTGGGGCGGATTACATGTCCAAGCT
GGTGAAGATTGCCGGGATCACAATCGCCGCGTCGAGGGTGAAAGCTAAGGCCACTCATGT
CACGCTGCTCTGCAAGAACTGCAGAAGTGTGAAAACGGTGCCGTGTAGGCCTGGCCTTGG
TGGGGCTATTGTCCCACGATCGTGCGACCATGTTCCTCAGCCTGGAGAAGAGCCTTGCCC
CTTGGACCCCTGGATTGCAGTTCCAGATAAGAGCAAGTATGTGGATCTCCAGACCCTCAA
ATTGCAGGAAAATCCTGAGGATGTTCCAACTGGTGAGCTCCCGAGGAATATGCTGCTGTC
CGTAGACAGGCATCTTGTTCAGACCATTGTTCCTGGAACTAGATTAACTGTAATTGGTAT
CTACAGTGTCTACCAAGCATCTGCAAACCAAAAGGGTGCTGTTGGAGTCAAACAGCCTTA
CATTAGAGTTGTGGGGTTGGAGCAGTCCCGAGATGCCAACTCGAATGGTCCCTCAAATTT
TACACTTGATGAGGAAATGGAATTCAAAGAATTTGCACAGAGGCCAGATGCATATGTCAA
GATTTGCTCAATGATTGGCCCTTCAATTTATGGCCATTCTGATGTCAAGAAAGCTATTGC
ATGCTTGCTGTTTGGTGGCTCAAAGAAGAGGCTACCGGATGGTGTCCGTTTGAGAGGGGA
CATTCATGTCTTGCTGCTGGGTGATCCATCAACAGCAAAATCACAGTTCCTCAAGTTTGT
GGAGAAGACAGCGCCGATTGCTGTCTATACATCTGGGAAAGGTTCATCAGCAGCTGGTCT
CACAGCGTCAGTAATTCGGGACGGTAGCTCTCGAGAGTTTTATTTGGAAGGAGGGGCCAT
GGTTTTGGCTGATGGTGGAGTTGTTTGTATTGATGAGTTTGACAAAATGAGGCCTGAGGA
CCGAGTTGCAATTCACGAAGCAATGGAACAGCAGACCATCTCGATTGCCAAAGCTGGCAT
TACAACAGTACTCAATTCAAGGACCTCGGTACTAGCAGCTGCCAATCCAATTGCAGGGCG
CTACGATGATCTTAAGACTGCACAAGATAACATTGATCTGCAGACAACCATCCTTTCTAG
ATTTGATCTAATCTTTATTGTTAAAGATGTCAGAATGTATGATCAAGACAAGCGAATTGC
AAGCCACATCATTAAGGTGCATGCCAGTGGTGCTGCTGCTTCATCCAAGAATACAGATGC
TAGTGAAGGAGAGAATTGGCTAAAAAGGTACATTGAGTATTGCCGTGTTACTTGTAAACC
ACGACTCTCAGAAAAGGCAGCAGAGATGCTTCAGAACAAATATGTGGAGATTAGACAGAA
AATGAGACAACAAGCTCATGAAACAGGGAGGGCTGCAGCTATACCCATCACTGTGCGGCA
GCTTGAAGCCATTATACGTTTGAGTGAATCTCTTGCAAAGATGAGATTGACAAGTGTGGC
TACACCAGAGCATGTTGAAGAGGCATTTAGGCTGTTCAATGTCTCCACTGTTGATGCCGC
AAGATCTGGAATCAATGAGCATTTGAACCTATCACCAGATATTGCAAATGAGATCAAGCA
AGCTGAGGCACAAATAAAGAGAAGGATGGGAATTGGAAGCCACATATCCGAGCGACGCCT
GATCGATGAACTAAATAGGATGGGGATGAATGAATCCATTGTGCGAAGAGCCCTTCTGAT
CATGCACCAAAGGGATGAAGTGGAGTACAAGAGAGAGCGCCATGTCATTGTCCGGAAGGC
TTGAGGTGAACTGTGGAGTATTTATAAATCGAGGACAACTTCTATTCAGACTGTATAAGG
CTATGAGTTCACTGAAACTGTAATCTCTGGGAGAAGACAAGGACATGTTTGAGTTTCGGT
TGATCACTGACATGACCATTGTAATCTGCAAGAGTAGAAGAAATGCACTCCGTCCTTGAT
GAAACTGTAGTTAAACTACAGTATTAAAGATGTAACTGTAGTGAAACCATGTAACCAGGG
TTCTGAAATGGCTAATGTATTAAACTACAGTATTAATTCATGGATATAAATGGCTAATAT
TCTGCAGTGCCCAGAC

CDS

2190 bp

>Os02t0797400-01 MCM family protein.
ATGTCGGGTTGGGACGAGGGCGCCGTCTTCTACAGCGACCAGGCGCAGTTCCCGCGCGGC
GGCCCCGGCGGCGACCCCTCCGCCGACCTCACCCGCCACTCCGCCCTCCGCAAGTTCAAG
GAGTTCCTCCGCGGCTTCACCGGCCCAACCGGCGACTTCCCCTACCGCGAGAGCCTGGTG
CACAACCGCGACCATGTCACCGTCGCCATCGAGGACCTCGACGCCTTCGACGCCGAGCTG
TCCGACAAGATCCGGAAGTCTCCCGCTGATTACCTACCGCTGTTTGAGACGGCTGCGTCC
GAGGTCCTCGCGAGCCTTCGGTCCAAGGTCGCTGGAGAGACCGGCGAGATGGAGGAGCCC
GCCACCGGCGACGTGCAGATCTTCTTGTCCTCAAAGGAGAACTGCCTGTCCATGAGGTCT
ATTGGGGCGGATTACATGTCCAAGCTGGTGAAGATTGCCGGGATCACAATCGCCGCGTCG
AGGGTGAAAGCTAAGGCCACTCATGTCACGCTGCTCTGCAAGAACTGCAGAAGTGTGAAA
ACGGTGCCGTGTAGGCCTGGCCTTGGTGGGGCTATTGTCCCACGATCGTGCGACCATGTT
CCTCAGCCTGGAGAAGAGCCTTGCCCCTTGGACCCCTGGATTGCAGTTCCAGATAAGAGC
AAGTATGTGGATCTCCAGACCCTCAAATTGCAGGAAAATCCTGAGGATGTTCCAACTGGT
GAGCTCCCGAGGAATATGCTGCTGTCCGTAGACAGGCATCTTGTTCAGACCATTGTTCCT
GGAACTAGATTAACTGTAATTGGTATCTACAGTGTCTACCAAGCATCTGCAAACCAAAAG
GGTGCTGTTGGAGTCAAACAGCCTTACATTAGAGTTGTGGGGTTGGAGCAGTCCCGAGAT
GCCAACTCGAATGGTCCCTCAAATTTTACACTTGATGAGGAAATGGAATTCAAAGAATTT
GCACAGAGGCCAGATGCATATGTCAAGATTTGCTCAATGATTGGCCCTTCAATTTATGGC
CATTCTGATGTCAAGAAAGCTATTGCATGCTTGCTGTTTGGTGGCTCAAAGAAGAGGCTA
CCGGATGGTGTCCGTTTGAGAGGGGACATTCATGTCTTGCTGCTGGGTGATCCATCAACA
GCAAAATCACAGTTCCTCAAGTTTGTGGAGAAGACAGCGCCGATTGCTGTCTATACATCT
GGGAAAGGTTCATCAGCAGCTGGTCTCACAGCGTCAGTAATTCGGGACGGTAGCTCTCGA
GAGTTTTATTTGGAAGGAGGGGCCATGGTTTTGGCTGATGGTGGAGTTGTTTGTATTGAT
GAGTTTGACAAAATGAGGCCTGAGGACCGAGTTGCAATTCACGAAGCAATGGAACAGCAG
ACCATCTCGATTGCCAAAGCTGGCATTACAACAGTACTCAATTCAAGGACCTCGGTACTA
GCAGCTGCCAATCCAATTGCAGGGCGCTACGATGATCTTAAGACTGCACAAGATAACATT
GATCTGCAGACAACCATCCTTTCTAGATTTGATCTAATCTTTATTGTTAAAGATGTCAGA
ATGTATGATCAAGACAAGCGAATTGCAAGCCACATCATTAAGGTGCATGCCAGTGGTGCT
GCTGCTTCATCCAAGAATACAGATGCTAGTGAAGGAGAGAATTGGCTAAAAAGGTACATT
GAGTATTGCCGTGTTACTTGTAAACCACGACTCTCAGAAAAGGCAGCAGAGATGCTTCAG
AACAAATATGTGGAGATTAGACAGAAAATGAGACAACAAGCTCATGAAACAGGGAGGGCT
GCAGCTATACCCATCACTGTGCGGCAGCTTGAAGCCATTATACGTTTGAGTGAATCTCTT
GCAAAGATGAGATTGACAAGTGTGGCTACACCAGAGCATGTTGAAGAGGCATTTAGGCTG
TTCAATGTCTCCACTGTTGATGCCGCAAGATCTGGAATCAATGAGCATTTGAACCTATCA
CCAGATATTGCAAATGAGATCAAGCAAGCTGAGGCACAAATAAAGAGAAGGATGGGAATT
GGAAGCCACATATCCGAGCGACGCCTGATCGATGAACTAAATAGGATGGGGATGAATGAA
TCCATTGTGCGAAGAGCCCTTCTGATCATGCACCAAAGGGATGAAGTGGAGTACAAGAGA
GAGCGCCATGTCATTGTCCGGAAGGCTTGA

Protein

730 aa

>Os02t0797400-01 MCM family protein.
MSGWDEGAVFYSDQAQFPRGGPGGDPSADLTRHSALRKFKEFLRGFTGPTGDFPYRESLV
HNRDHVTVAIEDLDAFDAELSDKIRKSPADYLPLFETAASEVLASLRSKVAGETGEMEEP
ATGDVQIFLSSKENCLSMRSIGADYMSKLVKIAGITIAASRVKAKATHVTLLCKNCRSVK
TVPCRPGLGGAIVPRSCDHVPQPGEEPCPLDPWIAVPDKSKYVDLQTLKLQENPEDVPTG
ELPRNMLLSVDRHLVQTIVPGTRLTVIGIYSVYQASANQKGAVGVKQPYIRVVGLEQSRD
ANSNGPSNFTLDEEMEFKEFAQRPDAYVKICSMIGPSIYGHSDVKKAIACLLFGGSKKRL
PDGVRLRGDIHVLLLGDPSTAKSQFLKFVEKTAPIAVYTSGKGSSAAGLTASVIRDGSSR
EFYLEGGAMVLADGGVVCIDEFDKMRPEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVL
AAANPIAGRYDDLKTAQDNIDLQTTILSRFDLIFIVKDVRMYDQDKRIASHIIKVHASGA
AASSKNTDASEGENWLKRYIEYCRVTCKPRLSEKAAEMLQNKYVEIRQKMRQQAHETGRA
AAIPITVRQLEAIIRLSESLAKMRLTSVATPEHVEEAFRLFNVSTVDAARSGINEHLNLS
PDIANEIKQAEAQIKRRMGIGSHISERRLIDELNRMGMNESIVRRALLIMHQRDEVEYKR
ERHVIVRKA*

5'UTR

chr02:33940413..33940506 (- strand) : 94 bp

CDS

chr02:33940246..33940412 (- strand) : 167 bp

chr02:33940040..33940154 (- strand) : 115 bp

chr02:33939810..33939953 (- strand) : 144 bp

chr02:33939556..33939735 (- strand) : 180 bp

chr02:33939367..33939465 (- strand) : 99 bp

chr02:33939128..33939255 (- strand) : 128 bp

chr02:33938928..33939033 (- strand) : 106 bp

chr02:33938708..33938842 (- strand) : 135 bp

chr02:33938526..33938603 (- strand) : 78 bp

chr02:33938351..33938455 (- strand) : 105 bp

chr02:33938175..33938266 (- strand) : 92 bp

chr02:33937926..33938058 (- strand) : 133 bp

chr02:33937712..33937807 (- strand) : 96 bp

chr02:33937549..33937643 (- strand) : 95 bp

chr02:33937367..33937457 (- strand) : 91 bp

chr02:33937181..33937290 (- strand) : 110 bp

chr02:33936888..33937017 (- strand) : 130 bp

chr02:33936706..33936807 (- strand) : 102 bp

chr02:33936541..33936624 (- strand) : 84 bp

3'UTR

chr02:33936229..33936540 (- strand) : 312 bp

FASTA

>Os02t0797400-01 class=Sequence position=chr02:33936229..33940506 (- strand)
GTCTTCCCCC CTTTCCCCGC CGCCCGCGCA CCCACGCGTC TCTCTCCCTC TCTCTCCGCC GCCGCCGCCG CCGCAGCCAG
CCAGCCATCC AGCCATGTCG GGTTGGGACG AGGGCGCCGT CTTCTACAGC GACCAGGCGC AGTTCCCGCG CGGCGGCCCC
GGCGGCGACC CCTCCGCCGA CCTCACCCGC CACTCCGCCC TCCGCAAGTT CAAGGAGTTC CTCCGCGGCT TCACCGGCCC
AACCGGCGAC TTCCCCTACC GGTGCGCCCC CCCTCCCTCC CAGATCTGGT GCCTCGTCGG ATGGTCGAAT TCGCTCTGAC
CAATCCAGTG TGTTTTTGTT TGATGGTTGC AGCGAGAGCC TGGTGCACAA CCGCGACCAT GTCACCGTCG CCATCGAGGA
CCTCGACGCC TTCGACGCCG AGCTGTCCGA CAAGATCCGG AAGTCTCCCG CTGATTACCT ACCGCTGGTG TGTGCTGGTT
CTTTCTGAAT TTTTGTTGGC TCTGGGTTCT GTTGATGTCA ATTTTTTGTG TTAAGATTTA GGGTTTTGTG TAGTTTGAGA
CGGCTGCGTC CGAGGTCCTC GCGAGCCTTC GGTCCAAGGT CGCTGGAGAG ACCGGCGAGA TGGAGGAGCC CGCCACCGGC
GACGTGCAGA TCTTCTTGTC CTCAAAGGAG AACTGCCTGT CCATGAGGTC TATTGGGGTC AGTTCTGAAA CGATTTTGTT
AGTAGCCTTG TGAAGAATTT CAAATTGACA CAACTGTATT CCAAATTCCA GGCGGATTAC ATGTCCAAGC TGGTGAAGAT
TGCCGGGATC ACAATCGCCG CGTCGAGGGT GAAAGCTAAG GCCACTCATG TCACGCTGCT CTGCAAGAAC TGCAGAAGTG
TGAAAACGGT GCCGTGTAGG CCTGGCCTTG GTGGGGCTAT TGTCCCACGA TCGTGCGACC ATGTTCCTCA GGTCTAACTC
CGGCTAAACA TAATTGGGTT ATTGTCTTGT TTGTGTTTTA ATTCTGATGT ATATGAGTGA GTTTTCTTTA CCATTTTTCA
GCCTGGAGAA GAGCCTTGCC CCTTGGACCC CTGGATTGCA GTTCCAGATA AGAGCAAGTA TGTGGATCTC CAGACCCTCA
AATTGCAGGA AAATCCTGAG GTTTGTTACT GCATTATATG TCCTCGCTGC GATGCTATGG TTTTCTAGGT TTATTGGTTA
TATGTCCTTA GGATTTAGCA ATCACCAAGC TGTATATTAC TTGGTTAACA GGATGTTCCA ACTGGTGAGC TCCCGAGGAA
TATGCTGCTG TCCGTAGACA GGCATCTTGT TCAGACCATT GTTCCTGGAA CTAGATTAAC TGTAATTGGT ATCTACAGTG
TCTACCAAGC ATCTGCAAAG TATGTTGGAT CTAAAACATC TGCTCAGTTT GTTTCCATTT TGTTGAGCTA GACTACTTGC
ATAGCTGATG ACGCTCAAAT ATTCATTTTG CAGCCAAAAG GGTGCTGTTG GAGTCAAACA GCCTTACATT AGAGTTGTGG
GGTTGGAGCA GTCCCGAGAT GCCAACTCGA ATGGTCCCTC AAATTTTACA CTTGATGAGG TAGATTGCTT TGCCAAAATT
CCAAGTTTCT TTTTTAAGAG TGTTACAGCA TATTTACAAT GTTAATTTTC TTGTTGGTTT GTAGGAAATG GAATTCAAAG
AATTTGCACA GAGGCCAGAT GCATATGTCA AGATTTGCTC AATGATTGGC CCTTCAATTT ATGGCCATTC TGATGTCAAG
AAAGCTATTG CATGCTTGCT GTTTGGTGGC TCAAAGAAGG TATATTTTTG ATCTTATCAG TGGCTAATAT GTGAAAATAC
AAAGTTGTGT TGGATCCAGT GGCTAGTTGG AATGAGCTGT AACTAAACTT TCTTCTATGG CAGAGGCTAC CGGATGGTGT
CCGTTTGAGA GGGGACATTC ATGTCTTGCT GCTGGGTGAT CCATCAACAG CAAAATCACA GGCAAGTGTT TTTTCGCTAT
TAGAAATGAA TTATCTCTAG TCCAGTGACA TGAAACTGTA CATTCCAACA GTTCCTCAAG TTTGTGGAGA AGACAGCGCC
GATTGCTGTC TATACATCTG GGAAAGGTTC ATCAGCAGCT GGTCTCACAG CGTCAGTAAT TCGGGACGGT AGCTCTGTAA
GCTTGTCTTC CCTGCAAGGA TTATTGTGTT TACTCAAAGT TCTGTTTCCT AGAACTAAAA GACTTATTTT CCCTGTACAG
CGAGAGTTTT ATTTGGAAGG AGGGGCCATG GTTTTGGCTG ATGGTGGAGT TGTTTGTATT GATGAGTTTG ACAAAATGAG
GCCTGAGGAC CGGTAAGCAT TGATCTATAG TCTTCTTTCT AGAAACTAAA ATAAGCATTG CACATGTAAT TTTTCCTTAC
TCTTCAAAGT TGAAACCATA TTGAGTTACC TTTATGCTGT GATTCCAGAG TTGCAATTCA CGAAGCAATG GAACAGCAGA
CCATCTCGAT TGCCAAAGCT GGCATTACAA CAGTACTCAA TTCAAGGACC TCGGTACTAG CAGCTGCCAA TCCAATTGCA
GGGCGCTACG ATGATCTTAA GGTCAGTCAA AGTTTTTATT ATTGACTTGT ACTATTTTCA TATTTTGAAA ATGTATTAAC
AGTTCTAGCC TTATATGCAA GGCAATCAGT TTGACACATT TTCTATTGCT ACTCCTCAGA CTGCACAAGA TAACATTGAT
CTGCAGACAA CCATCCTTTC TAGATTTGAT CTAATCTTTA TTGTTAAAGA TGTCAGAATG TATGATCAAG ACAAGGTATG
ACGCATTATT CTTTGTCCAG CTCATTGATG TGCTTCAGAG ACTAAATAAA CTTCCAATTG CAGCGAATTG CAAGCCACAT
CATTAAGGTG CATGCCAGTG GTGCTGCTGC TTCATCCAAG AATACAGATG CTAGTGAAGG AGAGAATTGG CTAAAAAGGT
GTGGTTGGCC TTCTATGTTC TGATATACAT ACTACACAGT TTTGATATGA TGTTCTTGGA TTGTAAATGC ATAATCCTCA
CATGTGTAGG TACATTGAGT ATTGCCGTGT TACTTGTAAA CCACGACTCT CAGAAAAGGC AGCAGAGATG CTTCAGAACA
AATATGTGGA GATTAGACAG GCACGTGCTA AAGATTTTTC ACTTAGTCTA ACTGTTATTA AGACTGTTCT ACTTATTTAT
TTTTTTCATT GTGCAGAAAA TGAGACAACA AGCTCATGAA ACAGGGAGGG CTGCAGCTAT ACCCATCACT GTGCGGCAGC
TTGAAGCCAT TATACGTTTG AGTGAATCTC TTGCAAAGAT GAGATTGTGA GAATATAGCA TTACTATACA TTTGACATTT
CTTTTTGCGA GTAGCTCAAC TAGCAGTATA TTTATATCTT ACATTTTTCA CATATTGGCT TTTATTTCCA GTGGGTCATA
ACTTACATGT TTTATAATGT TCCTAATTGG CACTTTGAAT AATTATCAGG ACAAGTGTGG CTACACCAGA GCATGTTGAA
GAGGCATTTA GGCTGTTCAA TGTCTCCACT GTTGATGCCG CAAGATCTGG AATCAATGAG CATTTGAACC TATCACCAGA
TATTGCAAAT GAGATCAAGG TTAATCTTCC CATCCAAAAG TGAACTGCCA ACTTGTCAAC TTTGTTTTCT GAATTTTGTT
GCCCATTTTG TTCCAACAGC AAGCTGAGGC ACAAATAAAG AGAAGGATGG GAATTGGAAG CCACATATCC GAGCGACGCC
TGATCGATGA ACTAAATAGG ATGGGGATGA ATGAATCCAT TGTGAGGAAC CTGTCATACT ATTTGCTATT TAATTAATTG
ATTTAGTATC ATTTTTCTTA TGCTACCATT CGGCTGCTTC AGGTGCGAAG AGCCCTTCTG ATCATGCACC AAAGGGATGA
AGTGGAGTAC AAGAGAGAGC GCCATGTCAT TGTCCGGAAG GCTTGAGGTG AACTGTGGAG TATTTATAAA TCGAGGACAA
CTTCTATTCA GACTGTATAA GGCTATGAGT TCACTGAAAC TGTAATCTCT GGGAGAAGAC AAGGACATGT TTGAGTTTCG
GTTGATCACT GACATGACCA TTGTAATCTG CAAGAGTAGA AGAAATGCAC TCCGTCCTTG ATGAAACTGT AGTTAAACTA
CAGTATTAAA GATGTAACTG TAGTGAAACC ATGTAACCAG GGTTCTGAAA TGGCTAATGT ATTAAACTAC AGTATTAATT
CATGGATATA AATGGCTAAT ATTCTGCAGT GCCCAGAC

Locus: Os02g0797400

Loading...

Locus: Os02g0797400

Loading...