Os02t0804500-01

Locus

Os02g0804500

Description

Molecular chaperone, heat shock protein, Hsp40, DnaJ domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDjA2

Oryzabase Gene Name Synonym(s)

DnaJ domain protein A2, rice DJA4 homolog

Transcript Evidence

AK068801 (DDBJ, Best hit)

Protein Evidence

B6U659 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Biological Process: response to heat (GO:0009408)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: heat shock protein binding (GO:0031072)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Heat shock protein DnaJ, cysteine-rich domain (IPR001305)

Heat shock protein DnaJ, N-terminal (IPR001623)

Chaperone DnaJ, C-terminal (IPR002939)

Heat shock protein DnaJ (IPR003095)

HSP40/DnaJ peptide-binding (IPR008971)

Chaperone DnaJ (IPR012724)

Heat shock protein DnaJ, conserved site (IPR018253)

Full-length cDNA

J013160I05 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0804500-01)

RiceXPro (AK068801)

Others

Oryzabase (12139)

KEGG (Os02t0804500-01)

Transcript

1938 bp

>Os02t0804500-01 Molecular chaperone, heat shock protein, Hsp40, DnaJ domain containing protein.
cggctctagaagcttctagaaggcgcagctgcagcgctggctaatggcgttcgcgacctc
cacgctcccattcgcgccatccaacccctcgccgtcctcccgctccgccgcagcggcttt
ctctccccgcggcggggtccacttcgccgccgctaggagcggcctcccgCTCGCGTGCGC
CGCGCCGAGGCACCGAGGGAGGCCTCCTCCGAGGAGGCGCCGCGGAGGGTGCCTGGTGGT
GTGGGCGTCCGCCGACTACTACGCCACGCTCGGCGTGCCGCGCTCCGCGAGCAACAAGGA
CATCAAGGCCGCCTACCGGAAGCTTGCGCGCCAGTACCATCCTGATGTCAATAAGGAACC
TGGAGCAACCGATAAGTTCAAAGAGATAAGTGCAGCATATGAGGTGCTATCAGATGAAAA
GAAGAGGGCGCTGTATGATCAATATGGTGAAGCTGGGGTTAGGAGTGCGGTTGGAGGCTC
AGCTGGAGCTTACACAAGTAATCCTTTTGATCTATTTGAGACATTCTTTGGAGCAAGCAT
GGGTGGCTTTTCTGGTATGGACCAGGGAACATTTAGGACACGCAGGAGGAGCACTGCTGT
TCAGGGGGAAGACATCAGATATGATGTGAATCTGGGGTTCTCAGAGGCAATATTTGGAAC
AGAAAAGGATATTATATTATCTCATTTGGAGACATGCGATGCATGTGCTGGTTCTGGATC
AAAGATTGGGTCGAAAATGAGAATATGCTCCACATGTGGTGGTCGAGGGCAAGTAATGAG
AACTGAGCAGACACCATTTGGTCTGTTCTCCCAGGTTTCAATTTGCCCCACCTGTGCAGG
AGAGGGTGAAGTCATTTCAGAGTATTGCAAGAAATGTGCTGGAGAGGGGCGTGTTCGTGT
TAGAAAGGAGATCAAAGTAAAAATTCCTCCAGGTGTTAGCAAAGGTAGTACTCTTCGTGT
ACGTGGTGAAGGTGATGCGGGACCAAAAGGAGGACCTCCTGGAGATCTTTTTGTTTGCCT
TGATATAGAGGAGCCAGCAGATATTAAAAGGGATGGTATCAACTTGTATTCAACTGTTTC
AGTAAGCTACATTGAAGCTATTCTGGGCACTGTTAAAAAGGTCAGAACTGTTGATGGAAA
TAGTGAACTTAGAATACCTCCAGGTACCCAACCTGGTGATGTAGTGGTTCTAGCAAAGCA
AGGTGTTCCATCATTGAATAAACCATCTGTTCGTGGTGATCATCTATTCACTATTAAGGT
CACTATACCCAAACGTATAAGCGGACGAGAAAAGGAGCTACTTGAGGAACTGGCTTCTTT
GAGCAATGGTGGTTTTGCTGGTGCACCTGTGAAGCCAAAATCCATACGCCAAGAGAATGA
AACTACTGTTGCCCAAGAAAATTCGGATCAACCTGATGAAGGGGAGGGTGACTGGTTGAA
GAAACTTCAAGATTTTGCAGGATCCATTGCTAATGGTGCTGCCAAGTGGCTAAAAGACAA
CCTTTAGCCTGTAAATAGTTACCGCGGAATGCATTTATATTAATCGCTGTTATGGTGTAG
TCCAATCTGCTATTCTTCAATTCATTGGATCCCACGAGCTGTTGCATTTGTTTTGGAGAG
GCTCAAAGTTCTCAGGCTGTGAAGTGGCAACGAAGAGGCTGAATCTGTTAATTAATTCCA
TCGGCAACGTTCTTATTTTGGTATGCTTGTAAAGTGGCATGATTTTTTATGTAGTTGCAG
TTATCATTCCCTAGAGCATGTGATGGTTTTACGTCACTTGCTGCTGATACTGAATTCAGT
AAAGATAATGCACTGTAAATATATATTTCATGCAGTAGAGCATCTTGAAATCTCAGGTAT
GTACTCTGTGGGTAAGCAACCGTGAGGTGTGTCGTTCTGAACTAGAGATATTTAAATCCA
GAACAAGAGCACCCATAT

CDS

1464 bp

>Os02t0804500-01 Molecular chaperone, heat shock protein, Hsp40, DnaJ domain containing protein.
atggcgttcgcgacctccacgctcccattcgcgccatccaacccctcgccgtcctcccgc
tccgccgcagcggctttctctccccgcggcggggtccacttcgccgccgctaggagcggc
ctcccgCTCGCGTGCGCCGCGCCGAGGCACCGAGGGAGGCCTCCTCCGAGGAGGCGCCGC
GGAGGGTGCCTGGTGGTGTGGGCGTCCGCCGACTACTACGCCACGCTCGGCGTGCCGCGC
TCCGCGAGCAACAAGGACATCAAGGCCGCCTACCGGAAGCTTGCGCGCCAGTACCATCCT
GATGTCAATAAGGAACCTGGAGCAACCGATAAGTTCAAAGAGATAAGTGCAGCATATGAG
GTGCTATCAGATGAAAAGAAGAGGGCGCTGTATGATCAATATGGTGAAGCTGGGGTTAGG
AGTGCGGTTGGAGGCTCAGCTGGAGCTTACACAAGTAATCCTTTTGATCTATTTGAGACA
TTCTTTGGAGCAAGCATGGGTGGCTTTTCTGGTATGGACCAGGGAACATTTAGGACACGC
AGGAGGAGCACTGCTGTTCAGGGGGAAGACATCAGATATGATGTGAATCTGGGGTTCTCA
GAGGCAATATTTGGAACAGAAAAGGATATTATATTATCTCATTTGGAGACATGCGATGCA
TGTGCTGGTTCTGGATCAAAGATTGGGTCGAAAATGAGAATATGCTCCACATGTGGTGGT
CGAGGGCAAGTAATGAGAACTGAGCAGACACCATTTGGTCTGTTCTCCCAGGTTTCAATT
TGCCCCACCTGTGCAGGAGAGGGTGAAGTCATTTCAGAGTATTGCAAGAAATGTGCTGGA
GAGGGGCGTGTTCGTGTTAGAAAGGAGATCAAAGTAAAAATTCCTCCAGGTGTTAGCAAA
GGTAGTACTCTTCGTGTACGTGGTGAAGGTGATGCGGGACCAAAAGGAGGACCTCCTGGA
GATCTTTTTGTTTGCCTTGATATAGAGGAGCCAGCAGATATTAAAAGGGATGGTATCAAC
TTGTATTCAACTGTTTCAGTAAGCTACATTGAAGCTATTCTGGGCACTGTTAAAAAGGTC
AGAACTGTTGATGGAAATAGTGAACTTAGAATACCTCCAGGTACCCAACCTGGTGATGTA
GTGGTTCTAGCAAAGCAAGGTGTTCCATCATTGAATAAACCATCTGTTCGTGGTGATCAT
CTATTCACTATTAAGGTCACTATACCCAAACGTATAAGCGGACGAGAAAAGGAGCTACTT
GAGGAACTGGCTTCTTTGAGCAATGGTGGTTTTGCTGGTGCACCTGTGAAGCCAAAATCC
ATACGCCAAGAGAATGAAACTACTGTTGCCCAAGAAAATTCGGATCAACCTGATGAAGGG
GAGGGTGACTGGTTGAAGAAACTTCAAGATTTTGCAGGATCCATTGCTAATGGTGCTGCC
AAGTGGCTAAAAGACAACCTTTAG

Protein

488 aa

>Os02t0804500-01 Molecular chaperone, heat shock protein, Hsp40, DnaJ domain containing protein.
MAFATSTLPFAPSNPSPSSRSAAAAFSPRGGVHFAAARSGLPLACAAPRHRGRPPPRRRR
GGCLVVWASADYYATLGVPRSASNKDIKAAYRKLARQYHPDVNKEPGATDKFKEISAAYE
VLSDEKKRALYDQYGEAGVRSAVGGSAGAYTSNPFDLFETFFGASMGGFSGMDQGTFRTR
RRSTAVQGEDIRYDVNLGFSEAIFGTEKDIILSHLETCDACAGSGSKIGSKMRICSTCGG
RGQVMRTEQTPFGLFSQVSICPTCAGEGEVISEYCKKCAGEGRVRVRKEIKVKIPPGVSK
GSTLRVRGEGDAGPKGGPPGDLFVCLDIEEPADIKRDGINLYSTVSVSYIEAILGTVKKV
RTVDGNSELRIPPGTQPGDVVVLAKQGVPSLNKPSVRGDHLFTIKVTIPKRISGREKELL
EELASLSNGGFAGAPVKPKSIRQENETTVAQENSDQPDEGEGDWLKKLQDFAGSIANGAA
KWLKDNL*

5'UTR

chr02:34307569..34307611 (- strand) : 43 bp

CDS

chr02:34307278..34307568 (- strand) : 291 bp

chr02:34306179..34306247 (- strand) : 69 bp

chr02:34305883..34305975 (- strand) : 93 bp

chr02:34305275..34305396 (- strand) : 122 bp

chr02:34304380..34304575 (- strand) : 196 bp

chr02:34303562..34303737 (- strand) : 176 bp

chr02:34303109..34303238 (- strand) : 130 bp

chr02:34302187..34302347 (- strand) : 161 bp

chr02:34302005..34302084 (- strand) : 80 bp

chr02:34301743..34301842 (- strand) : 100 bp

chr02:34301065..34301110 (- strand) : 46 bp

3'UTR

chr02:34300634..34301064 (- strand) : 431 bp

FASTA

>Os02t0804500-01 class=Sequence position=chr02:34300634..34307611 (- strand)
cggctctaga agcttctaga aggcgcagct gcagcgctgg ctaatggcgt tcgcgacctc cacgctccca ttcgcgccat
ccaacccctc gccgtcctcc cgctccgccg cagcggcttt ctctccccgc ggcggggtcc acttcgccgc cgctaggagc
ggcctcccgC TCGCGTGCGC CGCGCCGAGG CACCGAGGGA GGCCTCCTCC GAGGAGGCGC CGCGGAGGGT GCCTGGTGGT
GTGGGCGTCC GCCGACTACT ACGCCACGCT CGGCGTGCCG CGCTCCGCGA GCAACAAGGA CATCAAGGCC GCCTACCGGA
AGCTTGCGCG CCAGGTGCTC GACGCTTGTC CCCTCCCGCA CCAAGCTTCA ATTTTACTCG TCTTTATAGG AGTACTGTAG
TTTTTGGATT GCTTTCTTTA TGGACGATGT CGTACGGTTG AGAGTACACA ATCACCAATA CTGGAATTCG TTGGATACTT
GGATCACACA ACTGAAATTA TTCTGTTTCT GATAGTGTAT GCGATAGTTG CCGTATTACG GTATTAGATC AGCTCTGTGC
ACATCTGAGA AGGCCTCATT TTGTTCGCTA TTGACTTCTT TTGTTTGGAT AAAGTATGAC ATTTAGCCAT GACTTTTAGA
AGAACTTTCT GTGATATTAT CAAATGATGC CCTCATCACA GTGTTCCGGT TCTCCTTTTA GGGTTAGGAC ACCTTTGTCA
CTGGTTCTAG CAGTATTGAC GCTGACACCT TCAACTCTGA AAATCCCAAT GCCATCCTCA GTGGATGAAT GGCATGAGCG
TGCCATGCTG GAGCAACCAA CATTGGTGCC AGTTGCTGCA ACACTGGTCA GCAGGATTCT GGAATCTGGA CCATGTACTA
TGTTGCTCTG CCATCTAGGA CAAAGCCTAG ACATCTGATC CGAAATTCGT GCATTCAATC ATGTGCTTTT GCTAGTTTGT
AACCATCGGA GCGTATAGCT GGGTTTGGAG CAAAAAAGGC AAACTGGAAT AATATAATTG CAAACAAAGT AAGACCTCTG
AAGGTTCCCT TTGTTTCTGT CACCTGCTTT GGGCTGAACT AGGGAACTGT CATAACCTTA GAAGCCTACA TACAAAAAGC
AGGCTTTTGA ACCTACGAGA GGGTCTTATT TGGAGCTTAG CTAATGCTTC AAATACCCTT CAGACCAAGT CCTCGAGGTT
TTACTGAGCT GATTTTCATG GCTACTAATT TACTATGGGA TTTATATACT TTACCAAGTG GCATGTTTTT ACTCTTAACA
TCAAGCTGCT AAGATTCACA CAACATGCAC ACTTCTATTT TAATAGATAA GAGTTATTGA TAACATCTTC GCTTTTGTTT
TTAGTACCAT CCTGATGTCA ATAAGGAACC TGGAGCAACC GATAAGTTCA AAGAGATAAG TGCAGCATAT GAGGTATCCA
ATTCAGCATA ATTTGTTAAT TCATGTATTT GTCTGCTTTT TTACTTGTAT TTAATATTGC TGATAAGTTA TAGACTTTTA
CTATTGACAT GTGGATTTTT TTTTTTGCTG TAATAGTTTA CAACGTCACT GCTTCTGGTT TCTCTGTTTT GTGTTTCATT
TCCCTCTTTA TAAGTGCTTA ATTTCATTGT CATCAGGTGC TATCAGATGA AAAGAAGAGG GCGCTGTATG ATCAATATGG
TGAAGCTGGG GTTAGGAGTG CGGTTGGAGG CTCAGCTGGA GCTTACACAG TATGACAGCT TTGCTTTTCA ACTTAATTTT
TTCTATCAGC ACTtactccc tccatcccaa aatataaggg ataatgccct tttcatttgt cccaaaatat aaAAGATATT
AAATGTAGCA CAATAGCTTT TGTACTAGTT ATTCTCCACC TAGCACCTTT TGTACTAGTT TATTCCCCAC CTGTCAACTT
TTGTACTAGT TTATTCCTTA ACTACTAACT TTCGTATCAC TTTTTTATGG ATTTGACGGA TGTATTTGCC CTTTTGCTAC
TTCCTTATTT TTTGTGAAAA AAATGGCATA ATCCCTTATA TTGTGGGATA GAGGCCGTAC AAGGCAATAT ATTGAGTGTG
ATTATATAAT TATATGTGTA CTAGCTAAAA TTCTTTGGCT AATAAGGATA CTAGATTTTG CTTATTGACT AGTATTGTTT
ACCCTTTTCG CTCACAGATG GCTTCAGTTC TTTACCTGTT ATTTTCTATA TGCAGAGTAA TCCTTTTGAT CTATTTGAGA
CATTCTTTGG AGCAAGCATG GGTGGCTTTT CTGGTATGGA CCAGGGAACA TTTAGGACAC GCAGGAGGAG CACTGCTGTT
CAGGGGGAAG ACATCAGGTT CTGTTGCCAG ATATTCATGG TCAATGTGTT TATCTAGTTG AAATGATCAG CTAAAGCTGT
TTAAATAGCA TATGAATAGC AGCACTAATT ATTGTAGTTG TTACAAACTT TAAAACCAAT TTGGTATGTA TGCCTCGGAG
ATCTAGCATT ATTTGCATAC ATCTCAATCT AGATAAGGTA TTCATACAAC TTTAATGCTA TTTTCTACCT TTCCCATCGT
TTATCTTCCC TCTGTTGCCA GTATTTACGA GTGAGCACCC ACACTAGCTA TTCCCTTCTT AACACCCACA TTAGCTATTC
CCACATTGTT CCAAAGACAT GGCACTAGGA TATCATGGTT GTTTGCCACT ACCATTATCT TGGTCTTATA ACTCCCCTTA
TGCCCATGCT TGGTCAAAAT ACAGCTTACA GAAATAGCAT GTTTGGGCAA CAATGTTGAT TCATTCTCTG TGCCAAATGT
TTCTTTTTTG GTTCCTGTTT GTGTTTTGCC TTTTCGCAAA AGCTACTAAT ACCTAAGTTC AAACATTTCT GATATTGGTA
TTTTTTTTTT CTTGTGATCT TTTTTTTTTT CTGCAAACAA ACCAGGGATA CCAGACCAGC AGATTCTTAT ACAAAATTGT
TCTTGCTAAA ATTCTCTTAT CATTTTGTGA TAAAAACTAG TGTACTTTAT AGACTGACAT GAACTTATAC CATCAGATAT
GATGTGAATC TGGGGTTCTC AGAGGCAATA TTTGGAACAG AAAAGGATAT TATATTATCT CATTTGGAGA CATGCGATGC
ATGTGCTGGT TCTGGATCAA AGATTGGGTC GAAAATGAGA ATATGCTCCA CATGTGGTGG TCGAGGGCAA GTAATGAGAA
CTGAGCAGAC ACCATTTGGT CTGTTCTCCC AGGTAATAGC ATTCATAATA TTATTCCAGT GCTTTACCAT GAAAACATCT
GGCGATAATG TGACAGCTTT TGTCAGGTGC CATATGTGAA AATGAACATT AAACAGAACA GTAGAAGATC AGAATCAATA
CTATAAACAA GATCTCATGG AACTACAAAA TATATTTTCA AGATATACTA GGATGTGAAC AGTTTTTTGT TAGACAAATA
TAATGGTGTA AAATATACAT AAGTGGCAAA CATATAGATC AATGAGAAGG GAAAAGGGGT TAAATCTATT CCTAGCTTCA
TCATTGCTTA GTAAGAATAT TAGCTGTATT AACTTGGTTG TTTTCTCACT ACtgattctt tattattatt aatttataat
ggataaatta aaacagatca aaacaactga agaagaaaat atttactaat ttttctatca ttgaaaagat ataggtaacc
gaaatacgta ttcaAGCACA GTAGAATATA CAGGCTTTGC TTTTTACAAG ATTGTTGAAG ACTCGATACG TAACCGAAAT
ATAAATATTT ATAGCATTAG GGTGGCCTGT GTATCTAATT ATCTATGCAA ACGTTTTAGT TCATTTGATA CTTATTACAT
ATGTGATTAA CTTCTAATAT TTCTTGTTTT GTAGGTTTCA ATTTGCCCCA CCTGTGCAGG AGAGGGTGAA GTCATTTCAG
AGTATTGCAA GAAATGTGCT GGAGAGGGGC GTGTTCGTGT TAGAAAGGAG ATCAAAGTAA AAATTCCTCC AGGTGTTAGC
AAAGGTAGTA CTCTTCGTGT ACGTGGTGAA GGTGATGCGG GACCAAAAGG GTGAGTGATT CGTTTGTTAT TTATCTTGTC
TATACTTCAT ACTTGAATAT GTTAAGGCAC TCACCAGTGA AAATTGTGGT TTGTGGATAT TGGTCCTAGA GGCAAATAAA
TAGATCATTG GCATCCTCAT AGTATTTTCT GGTGCTTTAG CTTCTGCATG CACATGCGCT CTTGCTTTTG CCTTCATCCT
CTTTATTGTC TTATTTTACT ACACCACCCT CCTCTGTCTG CCTTCTATAT ACTTTTTGTG TGCATGCACA AATAATCCAT
GTGTAAATGC TATTAAAAAA AATGCCTAAA CCCTTTTTGC ATTTGGAAAG CAGAGGACCT CCTGGAGATC TTTTTGTTTG
CCTTGATATA GAGGAGCCAG CAGATATTAA AAGGGATGGT ATCAACTTGT ATTCAACTGT TTCAGTAAGC TACATTGAAG
CTATTCTGGG CACTGTTAAA AAGGTAAAAT TTTTCTTGTT ATGATTCAAA ATTGTGATAT TTAGTTTGGG TTGAAGCCCA
TTGCCATTCT TCATTAATGA GAGTACAACT AATAGGAAAT GAATGCCTGA ACCATCTCAC TTTTTAGTAA CGGAGAATAC
TAACATGCAA AAACTGAGTT TTGTGTTCTG AGTTCTGACC ACATTGGTTG TGTATAGGAT GTTTGGTATA TATTGTTGAT
TGACTCTATT GGTCTGCCTG AGCGTTTTTT ATATACTCTG TTTTCTTGTG ATAAGAAAAC ACCTACCTTT ATGCACAATG
ATTAGCAAAC CAAACAGGCA GTATTTTAAG TCATATTCCT AGAGGTACAC CAACTTGATC TTAATCTGCT GTTACCTTTT
TTGTTAAGAT AAATTTGATT ACACGATAAT CAGATCATTT TGTTGATTTG ACCTAATCCA AAACCATAGG ATGTAATGTG
CCTGACTTCT AATTGAGGCC AGCATTTCAT TGGGATTAAA TTTATATCAG CTTATTGTTA ATCATTTTAG CTCAGACTAA
TTAACCAATG CTGCAGCTAT GTTATCCTAG GTCTGATCAA ATTTGTTTAT CTGAGACTGA TTTGAGTTTT GAACCTTTTC
TAACAACCAT GGCAGTTCAG ATCAAAGTTA ATTATTTGTA CATATTTATT TTAGATTTGA GAGAAAGCAT GTCCTTGTAA
TGATTCTTGT GGTCTATAGT CTACTGGCAT TTCTGTCTTA TGCTCATATT CTTCTTCCAA GCAGGTCAGA ACTGTTGATG
GAAATAGTGA ACTTAGAATA CCTCCAGGTA CCCAACCTGG TGATGTAGTG GTTCTAGCAA AGCAAGGTGT TCCATCATTG
AATAAACCAT CTGTTCGTGG TGATCATCTA TTCACTATTA AGGTCACTAT ACCCAAACGT ATAAGGTTAT ATGCTTCCTG
ACTTGAACCT ACTTTCGAAT ACATACTGTT GGTCTAAATC TACATAATCA CTGAGCCCAT ATCTCTGTGA ATTTGTGTTC
CTTCCAGCGG ACGAGAAAAG GAGCTACTTG AGGAACTGGC TTCTTTGAGC AATGGTGGTT TTGCTGGTGC ACCTGTGAAG
CCAAAATGTA AGCAAGCTTA GCTATATCCC CCACCCTCCC CTCTTCCCTC CCTCCCTCTC CAGCAAAGAA TTCATTCTCA
TATTCTAACG TTACTATCGA AGTTTGATGA ATTTTTTATT TTTAGGAACT AGCCTTGGAA GGTACTAACG ATTTGCATTT
GCATTGCAGC CATACGCCAA GAGAATGAAA CTACTGTTGC CCAAGAAAAT TCGGATCAAC CTGATGAAGG GGAGGGTGAC
TGGTTGAAGA AACTTCAAGA TTTTGCAGGG TAAATATTAG CTGTTTCTTA TTACAATGCA ATTGAGTTCT GGGAGGGTTT
ACCTCATACA TTCATGCATC ATATTGCAAA TTTTGGGAAC TTGATCATTT GTAAAAAAAA TGCAAGGAAG TATAGGTTAT
AGTGAGAAAG AAAGAGAGCT GTATATTACA CTTAAAAAAG TTAGTGTTAT AACCAACCTT TATACATTTT CATTGATCTT
CTACATGTTT TTCTAAAGAT AAGTTACTGA GATAGTGAAT CCACATCAGC AAAATGTTTT TGTTACACTG AACATATAGT
TAATACTTTT CCTCTTTTGC TGTTTGGGGC AGCTGAAGTT TTTGAAAATA TGCTCTTTCA GTAATGATCC ATAATGAGGT
AAAACTGTTG TTACAGGACC TCCTTTACAG CAGGTTGTAG CCTGTCTAAC TCTGTTGGTT GCATTCATTT TTACTTCTAA
TATTGATTAG TGCAACCCTT GTTCCAAAAA TGAATAGAAG GAAAAATGCT AACTGACGGT CTCAATATAC ATACTTGCTT
CTATTGAAGT TTGAAAATAC AAATTGTGGA TTTCTTTGTT TCTCTATCCT ATGCAATTCT GCATTCTTTT GTTGATCATG
TTGCTTACTG AATTCTTTCA GATCCATTGC TAATGGTGCT GCCAAGTGGC TAAAAGACAA CCTTTAGCCT GTAAATAGTT
ACCGCGGAAT GCATTTATAT TAATCGCTGT TATGGTGTAG TCCAATCTGC TATTCTTCAA TTCATTGGAT CCCACGAGCT
GTTGCATTTG TTTTGGAGAG GCTCAAAGTT CTCAGGCTGT GAAGTGGCAA CGAAGAGGCT GAATCTGTTA ATTAATTCCA
TCGGCAACGT TCTTATTTTG GTATGCTTGT AAAGTGGCAT GATTTTTTAT GTAGTTGCAG TTATCATTCC CTAGAGCATG
TGATGGTTTT ACGTCACTTG CTGCTGATAC TGAATTCAGT AAAGATAATG CACTGTAAAT ATATATTTCA TGCAGTAGAG
CATCTTGAAA TCTCAGGTAT GTACTCTGTG GGTAAGCAAC CGTGAGGTGT GTCGTTCTGA ACTAGAGATA TTTAAATCCA
GAACAAGAGC ACCCATAT

Locus: Os02g0804500

Loading...

Locus: Os02g0804500

Loading...