Os02t0804900-01

Locus

Os02g0804900

Description

Ribonucleotide reductase, Chloroplast biogenesis

RAP-DB Gene Symbol Synonym(s)

RNRL2

RAP-DB Gene Name Synonym(s)

RIBONUCLEOTIDE REDUCTASE LARGE SUBUNIT 2

CGSNL Gene Symbol

RNRL2

CGSNL Gene Name

RIBONUCLEOTIDE REDUCTASE LARGE SUBUNIT 2

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

EU602346 (Genbank)

Protein Evidence

Q6K848 (UniProt)

Literature

PMID: 19297585

Note

Manual Curation

June 8, 2009

Gene Ontology (GO)

Biological Process: DNA replication (GO:0006260)

Biological Process: oxidation-reduction process (GO:0055114)

Cellular Component: ribonucleoside-diphosphate reductase complex (GO:0005971)

Molecular Function: ribonucleoside-diphosphate reductase activity (GO:0004748)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Ribonucleotide reductase large subunit, C-terminal (IPR000788)

ATP-cone (IPR005144)

Ribonucleotide reductase R1 subunit, N-terminal (IPR008926)

Ribonucleoside-diphosphate reductase, alpha subunit (IPR013346)

Ribonucleotide reductase large subunit, N-terminal (IPR013509)

Expression Databases

TENOR (Os02t0804900-00)

Others

Oryzabase (9031)

Transcript

3060 bp

>Os02t0804900-01 Ribonucleotide reductase, Chloroplast biogenesis
AGCGGGAGCAGGAGCAATGATCATCCTTAAAGTTGGGAGAATTGCCGCACACCAACTGAC
GTGTGGGGCCTCCAAACCGCAAGTACACCTATGCTGGCAATGCTGCCCTTGCCCCTCTCC
CGCCAACGAATCCCTCCACTCCCCAAAAGCAAAAACGCGCGCGAAAAATTTCAACTCCCG
CGCTTCTCCCACCGCATCCTCTCTCCCCTTGAGTATTTACTTTTCAAAATACATAAAGAA
AGGAAGGGAAGCCGAGTGATCACATCGCCGCAACCACCAACCTCTCGAGGCCGTTCGAAT
CCCTCTCTCTCTTCTCCAATTCCCCAATCACCGATCACCGCGCCGCCGATCGGGTTCGTG
TGTGTGCCCTCGACGTGTTCGACGGAAAGCCCGCGAGAAGCGGAGGCCGGCTGCGGCGAC
GGCGAGGATGTACGTGGTGAAGCGCGATGGGCGGCAGGAGGCGGTCCACTTCGACAAGAT
CACCGCGCGGCTCAAGAGGCTCAGCTACGGCCTCAGCCAGGAGCACTGCGATCCGGTCCT
CGTCGCGCAGAAGGTCTGCGCCGGCGTCTACAAGGGCGTCACCACCAGCCAGCTCGGCGA
GCTCGCGGCGGAGACCGCCGCCGCCATGACCGCCTCCCACCCCGACTACGCCTCGCTCGC
CGCGAGGATCGCGATCTCGAACCTGCACAAGACCACCATGAAGTCTTTCTCAGAGACGAT
AAAGGTCATGTACATGCATTACGATGAGCGATCTGGGCTGTTGGCTCCTCTGATTGCCGA
TGACGTCTATGAGATCATCATGAAGAATACCACCCGCTTGGACAGTGAGATAATTTATGA
CAGAGATTTTGACTATGACTACTTTGGTTTTAAGACCCTTGAGAGATCTTATCTGTTAAA
AGTTGTTGGGAAGGTTGTGGAAAGACCACAGCATATGCTAATGAGAGTTTCTATTGGGAT
ACACAAGGATGATATTGAATCTGCTATCAAAACGTACCACATGATGTCTCAGCGCTGGTT
TACTCATGCTTCGCCAACCCTTTTCAATGCTGGCACTCCAAGGCCTCAATTAAGTAGCTG
CTTCCTCATCTGCATGAACGATGATAGCATTGAGGGAATTTATGATACTCTCTCAGAATG
TGCTACCATAAGCAAATGTGCTGGTGGAATTGGTCTCTCAATTCACAATATTAGAGCTAC
TGGGAGTTACATTCGAGGAACAAATGGAACATCTAATGGGATTGTTCCCATGCTGCGTGT
TTTCAATGATACTGCACGTTATGTTGATCAAGGCGGAGGCAAGAGAAAAGGTGCATTTGC
TATATACTTGGAGCCTTGGCATGCTGATATTTTTGAGTTCCTTGATTTAAGAAAGAACCA
TGGAAAGGAGGAGAATCGTGCAAGAGATCTTTTCTATGCGCTCTGGATTCCAGATCTGTT
CATGGAAAGGGTGCAAAATAATGAAAACTGGTCATTGTTTTGTCCCAATGAAGCTCCAGG
TTTGGCTGACTGTTGGGGAGATGAGTTTCAGAATCTGTACAAGAAATATGAAAGAGAGGG
CAAGGCAAAGAAAGTTGTTTCAGCACAGGCGCTCTGGTTTGACATTTTGAAGGCACAGAT
AGAAACTGGAACACCATATATGCTTTATAAGGATTCTTGTAATAGAAAAAGTAACCAACA
AAACCTGGGGACAATTAAGTCTTCAAACTTGTGCACGGAGATTATTGAGTTCACAAGTCC
CACTGAAACTGCTGTGTGCAATCTAGCATCGATTGGTTTACCGCGTTTTGTAAGGGAAAA
GGGTGTTCCTATGGAGTCTCATCCGGCTAAGCTTGTTGGTAGTAATGGATCCAAAAACCG
ATATTTTGACTTTGATAAATTAGCTGAGATTACTTCAATTGTCACAAGGAATCTCAATAA
AATAATTGATACTAATTATTACCCTGTTGAGACTGCAAAGAGATCAAATATGAGGCACAG
GCCAATCGGAATCGGTGTTCAGGGCTTGGCAGACACCTTCATTTTACTTGGCATGCCATT
TGATTCAACAGAGGCTCAGCAATTGAACAAGGATATTTTTGAGACTATTTATTATCATGC
CTTGAAAGCTTCTGCTGAAATTGCTGCAAAAGAAGGTCCTTATGAAACTTATAGCGGGAG
CCCTGTCAGCAAGGGCATTCTTCAACCTGATATGTGGAATGTAGTTCCATCTGATAGATG
GAATTGGTCAGATTTAAGGGAGATGATTTCCAAAGTTGGAGTTAGGAACTCTCTTCTTAT
TGCTCCAATGCCTACCGCTTCTACTAGTCAAATTCTTGGCAACAACGAATGCTTTGAACC
ATACACCTCAAACATATACAGTCGGAGAGTTTTAAGTGGCGAGTTTGTTGTAGTAAACAA
GCATCTTCTCCATGATTTGACTGAGATGGGTATTTGGTCCCCTGTTCTGAAAAACAAGAT
TGTCTATGAAGATGGTTCTGTTCAAAAGATCTCTGAGATCCCAGATGATCTGAAAGCAAT
TTACAGAACCGTGTGGGAAATCAAGCAGAAAACTATTGTTGACATGGCCATCGATCGTGG
TTGTTATATCGATCAGAGCCAAAGTCTTAATATCCACATGGACCAACCGAACTTTGGGAA
GCTAACTTCCCTGCACTTCCACGCTTGGTCCAAGGGCCTGAAAACTGGAATGTATTATCT
AAGAACACGCGCTGCTGCCGATGCAATCAAATTCACAGTGGACACTACTCTCCTCAAGGA
TAAGCAGCATAATGCAGAGGAAGAGGATGTCCAGTCTAAAATGGCAGAGGTGGTGTGTTC
CTTGAACAACCGGGACGAATGCTTGGCATGTGGTAGTTAGGTTCGTCCAAATCACATCTA
CCTTATCCTGACCTATATATATGACCTTATACTGCCCCTAGGCTAAACCGGCTTATCTTT
CGATCTCAATAGTGGTAACCCGTGTTTGGTGCACTCTGAAATTCTGGATTGAGGCTATCA
GACAAGACTTATTTTTAGAACTTCACCGTTGGCTTGTATATTTATGCTTAGGCTACTGTG

CDS

2433 bp

>Os02t0804900-01 Ribonucleotide reductase, Chloroplast biogenesis
ATGTACGTGGTGAAGCGCGATGGGCGGCAGGAGGCGGTCCACTTCGACAAGATCACCGCG
CGGCTCAAGAGGCTCAGCTACGGCCTCAGCCAGGAGCACTGCGATCCGGTCCTCGTCGCG
CAGAAGGTCTGCGCCGGCGTCTACAAGGGCGTCACCACCAGCCAGCTCGGCGAGCTCGCG
GCGGAGACCGCCGCCGCCATGACCGCCTCCCACCCCGACTACGCCTCGCTCGCCGCGAGG
ATCGCGATCTCGAACCTGCACAAGACCACCATGAAGTCTTTCTCAGAGACGATAAAGGTC
ATGTACATGCATTACGATGAGCGATCTGGGCTGTTGGCTCCTCTGATTGCCGATGACGTC
TATGAGATCATCATGAAGAATACCACCCGCTTGGACAGTGAGATAATTTATGACAGAGAT
TTTGACTATGACTACTTTGGTTTTAAGACCCTTGAGAGATCTTATCTGTTAAAAGTTGTT
GGGAAGGTTGTGGAAAGACCACAGCATATGCTAATGAGAGTTTCTATTGGGATACACAAG
GATGATATTGAATCTGCTATCAAAACGTACCACATGATGTCTCAGCGCTGGTTTACTCAT
GCTTCGCCAACCCTTTTCAATGCTGGCACTCCAAGGCCTCAATTAAGTAGCTGCTTCCTC
ATCTGCATGAACGATGATAGCATTGAGGGAATTTATGATACTCTCTCAGAATGTGCTACC
ATAAGCAAATGTGCTGGTGGAATTGGTCTCTCAATTCACAATATTAGAGCTACTGGGAGT
TACATTCGAGGAACAAATGGAACATCTAATGGGATTGTTCCCATGCTGCGTGTTTTCAAT
GATACTGCACGTTATGTTGATCAAGGCGGAGGCAAGAGAAAAGGTGCATTTGCTATATAC
TTGGAGCCTTGGCATGCTGATATTTTTGAGTTCCTTGATTTAAGAAAGAACCATGGAAAG
GAGGAGAATCGTGCAAGAGATCTTTTCTATGCGCTCTGGATTCCAGATCTGTTCATGGAA
AGGGTGCAAAATAATGAAAACTGGTCATTGTTTTGTCCCAATGAAGCTCCAGGTTTGGCT
GACTGTTGGGGAGATGAGTTTCAGAATCTGTACAAGAAATATGAAAGAGAGGGCAAGGCA
AAGAAAGTTGTTTCAGCACAGGCGCTCTGGTTTGACATTTTGAAGGCACAGATAGAAACT
GGAACACCATATATGCTTTATAAGGATTCTTGTAATAGAAAAAGTAACCAACAAAACCTG
GGGACAATTAAGTCTTCAAACTTGTGCACGGAGATTATTGAGTTCACAAGTCCCACTGAA
ACTGCTGTGTGCAATCTAGCATCGATTGGTTTACCGCGTTTTGTAAGGGAAAAGGGTGTT
CCTATGGAGTCTCATCCGGCTAAGCTTGTTGGTAGTAATGGATCCAAAAACCGATATTTT
GACTTTGATAAATTAGCTGAGATTACTTCAATTGTCACAAGGAATCTCAATAAAATAATT
GATACTAATTATTACCCTGTTGAGACTGCAAAGAGATCAAATATGAGGCACAGGCCAATC
GGAATCGGTGTTCAGGGCTTGGCAGACACCTTCATTTTACTTGGCATGCCATTTGATTCA
ACAGAGGCTCAGCAATTGAACAAGGATATTTTTGAGACTATTTATTATCATGCCTTGAAA
GCTTCTGCTGAAATTGCTGCAAAAGAAGGTCCTTATGAAACTTATAGCGGGAGCCCTGTC
AGCAAGGGCATTCTTCAACCTGATATGTGGAATGTAGTTCCATCTGATAGATGGAATTGG
TCAGATTTAAGGGAGATGATTTCCAAAGTTGGAGTTAGGAACTCTCTTCTTATTGCTCCA
ATGCCTACCGCTTCTACTAGTCAAATTCTTGGCAACAACGAATGCTTTGAACCATACACC
TCAAACATATACAGTCGGAGAGTTTTAAGTGGCGAGTTTGTTGTAGTAAACAAGCATCTT
CTCCATGATTTGACTGAGATGGGTATTTGGTCCCCTGTTCTGAAAAACAAGATTGTCTAT
GAAGATGGTTCTGTTCAAAAGATCTCTGAGATCCCAGATGATCTGAAAGCAATTTACAGA
ACCGTGTGGGAAATCAAGCAGAAAACTATTGTTGACATGGCCATCGATCGTGGTTGTTAT
ATCGATCAGAGCCAAAGTCTTAATATCCACATGGACCAACCGAACTTTGGGAAGCTAACT
TCCCTGCACTTCCACGCTTGGTCCAAGGGCCTGAAAACTGGAATGTATTATCTAAGAACA
CGCGCTGCTGCCGATGCAATCAAATTCACAGTGGACACTACTCTCCTCAAGGATAAGCAG
CATAATGCAGAGGAAGAGGATGTCCAGTCTAAAATGGCAGAGGTGGTGTGTTCCTTGAAC
AACCGGGACGAATGCTTGGCATGTGGTAGTTAG

Protein

811 aa

>Os02t0804900-01 Ribonucleotide reductase, Chloroplast biogenesis
MYVVKRDGRQEAVHFDKITARLKRLSYGLSQEHCDPVLVAQKVCAGVYKGVTTSQLGELA
AETAAAMTASHPDYASLAARIAISNLHKTTMKSFSETIKVMYMHYDERSGLLAPLIADDV
YEIIMKNTTRLDSEIIYDRDFDYDYFGFKTLERSYLLKVVGKVVERPQHMLMRVSIGIHK
DDIESAIKTYHMMSQRWFTHASPTLFNAGTPRPQLSSCFLICMNDDSIEGIYDTLSECAT
ISKCAGGIGLSIHNIRATGSYIRGTNGTSNGIVPMLRVFNDTARYVDQGGGKRKGAFAIY
LEPWHADIFEFLDLRKNHGKEENRARDLFYALWIPDLFMERVQNNENWSLFCPNEAPGLA
DCWGDEFQNLYKKYEREGKAKKVVSAQALWFDILKAQIETGTPYMLYKDSCNRKSNQQNL
GTIKSSNLCTEIIEFTSPTETAVCNLASIGLPRFVREKGVPMESHPAKLVGSNGSKNRYF
DFDKLAEITSIVTRNLNKIIDTNYYPVETAKRSNMRHRPIGIGVQGLADTFILLGMPFDS
TEAQQLNKDIFETIYYHALKASAEIAAKEGPYETYSGSPVSKGILQPDMWNVVPSDRWNW
SDLREMISKVGVRNSLLIAPMPTASTSQILGNNECFEPYTSNIYSRRVLSGEFVVVNKHL
LHDLTEMGIWSPVLKNKIVYEDGSVQKISEIPDDLKAIYRTVWEIKQKTIVDMAIDRGCY
IDQSQSLNIHMDQPNFGKLTSLHFHAWSKGLKTGMYYLRTRAAADAIKFTVDTTLLKDKQ
HNAEEEDVQSKMAEVVCSLNNRDECLACGS*

5'UTR

chr02:34327974..34328400 (+ strand) : 427 bp

CDS

chr02:34328401..34328628 (+ strand) : 228 bp

chr02:34328729..34328790 (+ strand) : 62 bp

chr02:34328880..34328967 (+ strand) : 88 bp

chr02:34329512..34329775 (+ strand) : 264 bp

chr02:34329853..34330093 (+ strand) : 241 bp

chr02:34330179..34330255 (+ strand) : 77 bp

chr02:34330344..34330514 (+ strand) : 171 bp

chr02:34330591..34330683 (+ strand) : 93 bp

chr02:34330764..34330913 (+ strand) : 150 bp

chr02:34330998..34331084 (+ strand) : 87 bp

chr02:34331163..34331327 (+ strand) : 165 bp

chr02:34331407..34331526 (+ strand) : 120 bp

chr02:34331751..34331953 (+ strand) : 203 bp

chr02:34332054..34332203 (+ strand) : 150 bp

chr02:34332286..34332433 (+ strand) : 148 bp

chr02:34332553..34332636 (+ strand) : 84 bp

chr02:34332714..34332815 (+ strand) : 102 bp

3'UTR

chr02:34332816..34333015 (+ strand) : 200 bp

FASTA

>Os02t0804900-01 class=Sequence position=chr02:34327974..34333015 (+ strand)
AGCGGGAGCA GGAGCAATGA TCATCCTTAA AGTTGGGAGA ATTGCCGCAC ACCAACTGAC GTGTGGGGCC TCCAAACCGC
AAGTACACCT ATGCTGGCAA TGCTGCCCTT GCCCCTCTCC CGCCAACGAA TCCCTCCACT CCCCAAAAGC AAAAACGCGC
GCGAAAAATT TCAACTCCCG CGCTTCTCCC ACCGCATCCT CTCTCCCCTT GAGTATTTAC TTTTCAAAAT ACATAAAGAA
AGGAAGGGAA GCCGAGTGAT CACATCGCCG CAACCACCAA CCTCTCGAGG CCGTTCGAAT CCCTCTCTCT CTTCTCCAAT
TCCCCAATCA CCGATCACCG CGCCGCCGAT CGGGTTCGTG TGTGTGCCCT CGACGTGTTC GACGGAAAGC CCGCGAGAAG
CGGAGGCCGG CTGCGGCGAC GGCGAGGATG TACGTGGTGA AGCGCGATGG GCGGCAGGAG GCGGTCCACT TCGACAAGAT
CACCGCGCGG CTCAAGAGGC TCAGCTACGG CCTCAGCCAG GAGCACTGCG ATCCGGTCCT CGTCGCGCAG AAGGTCTGCG
CCGGCGTCTA CAAGGGCGTC ACCACCAGCC AGCTCGGCGA GCTCGCGGCG GAGACCGCCG CCGCCATGAC CGCCTCCCAC
CCCGACTACG CCTCGGTAAG GCCCTCCGCG ACTGATCCGT ACGCTACACG CGGTCGTCTG GGGCGATCCG ATGGTTATTG
ACTGGATGTG GCGCTGATTC ATTTACACTG TGAAGCTCGC CGCGAGGATC GCGATCTCGA ACCTGCACAA GACCACCATG
AAGTCTTTCT CAGAGACGTA CGTTCTGATC CCTTTTTTCT TATTTGCTGG TATAGAAATG TTGATGATCT GTGTTGTGAA
GTGGTTACGT TGATCTCTGC ATGCAGGATA AAGGTCATGT ACATGCATTA CGATGAGCGA TCTGGGCTGT TGGCTCCTCT
GATTGCCGAT GACGTCTATG AGATCATCAT GAAGGTGAGA TACATTCTTA TCAAAATCAG TTTGGAAGTT CCTTAACATT
TTTACAGCAT GTGTGCTTCT GCAATATGGC ATGCATGAAG ATTGCAATTA ACATTTGTGA CGATGACCGC CTCGCAAATT
GTTAACTGTT TATTTGTTTT CTTATGATAT TATTCCCCCA AAAAGATTGT TTCCGAATCA TGTATTGCTG CAATATGTCA
CTTTCTATAG AATCGCACCA ATAGGTTGTT CTTCAACATT TATTTACTAA CATTTTATTC ACGTGTATTG CCGTGACTCT
TTGTTTACTT CTGTTCTTTT GGATCCATTA TGATGCTTAT GTTGCCCGTC ATTTGGTTTG AAATTCATAT TTGATGATCT
GATATTTGTT TAGCTTTATT GGCTTTGTTG GAGTTCTTGA AATTTTCTTA TATCAATGCT GCTTTTTTGC GTTGTTCAAT
TTCTTGTGTG GATATATTTC TTCAGGTGCT TCAATTTTTT ATTATATGTA TATTGTGCCA ATGTGACTTG ATAATTTCTA
TATGATGCAC CATTTCAGAA TACCACCCGC TTGGACAGTG AGATAATTTA TGACAGAGAT TTTGACTATG ACTACTTTGG
TTTTAAGACC CTTGAGAGAT CTTATCTGTT AAAAGTTGTT GGGAAGGTTG TGGAAAGACC ACAGCATATG CTAATGAGAG
TTTCTATTGG GATACACAAG GATGATATTG AATCTGCTAT CAAAACGTAC CACATGATGT CTCAGCGCTG GTTTACTCAT
GCTTCGCCAA CCCTTTTCAA TGCTGGCACT CCAAGGCCTC AAGTAATATG CTTCCTACCA TTGAAGTCCA ATTTGGATTA
TTAAAAATGG TCTCTTATGC TCCTCTCTGT TTTATGCAGT TAAGTAGCTG CTTCCTCATC TGCATGAACG ATGATAGCAT
TGAGGGAATT TATGATACTC TCTCAGAATG TGCTACCATA AGCAAATGTG CTGGTGGAAT TGGTCTCTCA ATTCACAATA
TTAGAGCTAC TGGGAGTTAC ATTCGAGGAA CAAATGGAAC ATCTAATGGG ATTGTTCCCA TGCTGCGTGT TTTCAATGAT
ACTGCACGTT ATGTTGATCA AGGCGGAGGC AAGAGAAAAG GTAAATACCA TCAGTTAGTT AGACATGGAC CTAATTTACA
TGTTCAGTGT TCAGGATTTC TTATGGATTC CTAACATTAA TTTAGGTGCA TTTGCTATAT ACTTGGAGCC TTGGCATGCT
GATATTTTTG AGTTCCTTGA TTTAAGAAAG AACCATGGAA AGGTAAAGGC TGTTGAAAGG ATGCATTTTC TGATAGACAT
TAGAAATTGA TAACACAGAA ACACATTTAC TCACCATGTG CAATTCGCAG GAGGAGAATC GTGCAAGAGA TCTTTTCTAT
GCGCTCTGGA TTCCAGATCT GTTCATGGAA AGGGTGCAAA ATAATGAAAA CTGGTCATTG TTTTGTCCCA ATGAAGCTCC
AGGTTTGGCT GACTGTTGGG GAGATGAGTT TCAGAATCTG TACAAGAAAT ATGAAAGAGA GGTAAGATGT GTGCTGGGTG
TGCAGTTTAT TGAAGTAATA TCTAAAGAAT ATTTGTTAAC CTAGCATGCA ATTTCAGGGC AAGGCAAAGA AAGTTGTTTC
AGCACAGGCG CTCTGGTTTG ACATTTTGAA GGCACAGATA GAAACTGGAA CACCATATAT GCTTTATAAG GTGTGCAATT
CATAAAGGGA ACAGTAGTTT GCCTACAATT CTGTTGCCAC ATATGCTTAT TTCTGAAATC TGGTCTGCAG GATTCTTGTA
ATAGAAAAAG TAACCAACAA AACCTGGGGA CAATTAAGTC TTCAAACTTG TGCACGGAGA TTATTGAGTT CACAAGTCCC
ACTGAAACTG CTGTGTGCAA TCTAGCATCG ATTGGTTTAC CGCGTTTTGT AAGGGAAAAG GTATGCACTA TGCAGTACTG
GCTGTATAAT TTTTGATTTG TTGTAGGTTG AAATTTCTGT ATCTCACGAC ACAAATTTGT TCAGGGTGTT CCTATGGAGT
CTCATCCGGC TAAGCTTGTT GGTAGTAATG GATCCAAAAA CCGATATTTT GACTTTGATA AATTAGCTGA GGTTTGTGTT
TAATATTTAC TTACTTTATG CCTCTTCCCC ACTAGCCTGA ATGCTACTAA TATTTGTTGG TTATTGCAGA TTACTTCAAT
TGTCACAAGG AATCTCAATA AAATAATTGA TACTAATTAT TACCCTGTTG AGACTGCAAA GAGATCAAAT ATGAGGCACA
GGCCAATCGG AATCGGTGTT CAGGGCTTGG CAGACACCTT CATTTTACTT GGCATGCCAT TTGATTCAAC AGAGGTAAAT
TTTTCCAACC TAAAAATGTG GTTATTCCAA TCTATATATA CTTCGCTGAA ATGCGATGCA ATGATCTTTT CAGGCTCAGC
AATTGAACAA GGATATTTTT GAGACTATTT ATTATCATGC CTTGAAAGCT TCTGCTGAAA TTGCTGCAAA AGAAGGTCCT
TATGAAACTT ATAGCGGGAG CCCTGTCAGC AAGGTTAGTG CCTGATGTCC AATAACTTTC CCAGCATTTA TGTTGCAGGT
GCCAATCCGG CCAAGAAAAA TGCTGCCTGT ATGATTTGCT ATTCTTTCTC AAGTAGTTTA AGTAAGATAT TGAAACTCTT
AGGGCTTTTG AATTGAAATG TCATTTTGTT ATTTGATATC TGGGTTGCAA TAGCCAATAC TATGTTCTAA GGCTGTACTC
AATGCATCTC CTACCAGGGC ATTCTTCAAC CTGATATGTG GAATGTAGTT CCATCTGATA GATGGAATTG GTCAGATTTA
AGGGAGATGA TTTCCAAAGT TGGAGTTAGG AACTCTCTTC TTATTGCTCC AATGCCTACC GCTTCTACTA GTCAAATTCT
TGGCAACAAC GAATGCTTTG AACCATACAC CTCAAACATA TACAGTCGGA GAGTTTTAAG GTCTGCAAAT CTGCTCCTTG
TTAAACGTTC AACCGTTGTT TTGGTTACAT GAATTTTTGC CAGTCTGTTT TGGTTTACAT GACTAGTTTC CTTTTGGCAG
TGGCGAGTTT GTTGTAGTAA ACAAGCATCT TCTCCATGAT TTGACTGAGA TGGGTATTTG GTCCCCTGTT CTGAAAAACA
AGATTGTCTA TGAAGATGGT TCTGTTCAAA AGATCTCTGA GATCCCAGAT GATCTGAAAG CAATTTACAG GTTTGTGAAT
TATCATGTCA GCTATAGTCT CATAAGATGC CAACTATCAC TTGTGTCTAA ATGTATCCTG TCATTGAATC AGAACCGTGT
GGGAAATCAA GCAGAAAACT ATTGTTGACA TGGCCATCGA TCGTGGTTGT TATATCGATC AGAGCCAAAG TCTTAATATC
CACATGGACC AACCGAACTT TGGGAAGCTA ACTTCCCTGC ACTTCCACGC TTGGTCCAAG GTAAAATTTT TAGTTTCAGT
TCATGTTCAA TTTATAATTC TGCATCAAGT TCTTCTACAG TTCACGTTTT TGCAGCTATC TTGAATAGTA TATGCATGAA
CTAAATTGTT TGATGCCAGG GCCTGAAAAC TGGAATGTAT TATCTAAGAA CACGCGCTGC TGCCGATGCA ATCAAATTCA
CAGTGGACAC TACTCTCCTC AAGGTGATTC GACAACTATA TACAGATTTT GCATCATATT TTACACATGA TTCTTACCCT
GAGAAACGCT GCATGTGCAG GATAAGCAGC ATAATGCAGA GGAAGAGGAT GTCCAGTCTA AAATGGCAGA GGTGGTGTGT
TCCTTGAACA ACCGGGACGA ATGCTTGGCA TGTGGTAGTT AGGTTCGTCC AAATCACATC TACCTTATCC TGACCTATAT
ATATGACCTT ATACTGCCCC TAGGCTAAAC CGGCTTATCT TTCGATCTCA ATAGTGGTAA CCCGTGTTTG GTGCACTCTG
AAATTCTGGA TTGAGGCTAT CAGACAAGAC TTATTTTTAG AACTTCACCG TTGGCTTGTA TATTTATGCT TAGGCTACTG
TG