Os02t0805100-01

Locus

Os02g0805100

Description

Similar to Auxin-responsive protein IAA12 (Indoleacetic acid-induced protein 12) (BODENLOS protein).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA9

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA9, OsIAA2

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 9

Transcript Evidence

AK073365 (DDBJ, Best hit)

Protein Evidence

Q6K846 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

J033030K18 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0805100-01)

RiceXPro (AK073365)

Others

Oryzabase (10900)

KEGG (Os02t0805100-01)

Transcript

1011 bp

>Os02t0805100-01 Similar to Auxin-responsive protein IAA12 (Indoleacetic acid-induced protein 12) (BODENLOS protein).
AAAGTCATCGCCATCATCGATCGATCGATCACAACTACTAGAAATCCAGCCAAGAAGATC
GAGACCGGATACAGCTAGCAATCCATCCAAGAAGATCGAGAGAGCGGATACAGCTAGCCT
AGCTACGCGAAGGATCAGATCATCGGCATGGAGCTGGAGCTTGGGCTGGCGCCACCGAAT
TCCGGTCATCTCGTCGTCGACGAGCTCAGCAGCAGCAGCAGCAGCGGCGGCGGCAGCGGC
AGCGCGCCGGTGTCTGCCTCGTCGGCCGGGAAGAGGGGATTCAGGGAGGCGTTCCAGGAG
ACGCTGCTGCTCTTCGACGACGGCAGCTGCTGCAACACCAGCGACGACGATTGCAGGAGG
AGGAAGAAGACGGTGGTGGGGTGGCCACCGGTGAGCTCGGCGCGGCGGGCGTGCGGCGGC
GCCAACTACGTGAAGGTGAAGAAGGAAGGCGACGCCATCGGGAGGAAGGTTGATTTGGCC
CTCCATTCCTCCTACGACGAGCTCGCTGCCACGCTCGCCCGCATGTTCCCCACCAACGAC
CACCAAGGCGAGAAGAAAATGGCCAATGATGATCATGGCGATGCCGCTGGACCTGTGGTC
ACCTACGAGGATGGTGATGGGGATTGGATGCTGGTTGGGGACGTGCCATGGGATGATTTT
GCACGATCTGTGAAACGCCTGAAGATACTGGGTTAACTGAACTGAAGGAGATGCATGCGT
GAGTTGATGGAGCACAGCTCGGTTTTGGTTGCCTGGCATCTGCGTGTGGGTGTGCACTGA
TGTATGTACATGTTTTCGTTTTCAGTCAGGATGTTAGGACGAGAGAAAGAGCTTTCTGTC
AAAGACTATATACTGCTAGCTTATATATACTGTAGTTGGGCACATCTCATGTGTGCCCAG
GGCTAGGTTTTGAGAATGTTTACAGAGTTCTGTGTTTTTACACCTTCTATATGTTTTGCA
AACTGATCTTGTACTATAATACTACTTTTATTTATTTCTCTCTTTTTTTTC

CDS

549 bp

>Os02t0805100-01 Similar to Auxin-responsive protein IAA12 (Indoleacetic acid-induced protein 12) (BODENLOS protein).
ATGGAGCTGGAGCTTGGGCTGGCGCCACCGAATTCCGGTCATCTCGTCGTCGACGAGCTC
AGCAGCAGCAGCAGCAGCGGCGGCGGCAGCGGCAGCGCGCCGGTGTCTGCCTCGTCGGCC
GGGAAGAGGGGATTCAGGGAGGCGTTCCAGGAGACGCTGCTGCTCTTCGACGACGGCAGC
TGCTGCAACACCAGCGACGACGATTGCAGGAGGAGGAAGAAGACGGTGGTGGGGTGGCCA
CCGGTGAGCTCGGCGCGGCGGGCGTGCGGCGGCGCCAACTACGTGAAGGTGAAGAAGGAA
GGCGACGCCATCGGGAGGAAGGTTGATTTGGCCCTCCATTCCTCCTACGACGAGCTCGCT
GCCACGCTCGCCCGCATGTTCCCCACCAACGACCACCAAGGCGAGAAGAAAATGGCCAAT
GATGATCATGGCGATGCCGCTGGACCTGTGGTCACCTACGAGGATGGTGATGGGGATTGG
ATGCTGGTTGGGGACGTGCCATGGGATGATTTTGCACGATCTGTGAAACGCCTGAAGATA
CTGGGTTAA

Protein

183 aa

>Os02t0805100-01 Similar to Auxin-responsive protein IAA12 (Indoleacetic acid-induced protein 12) (BODENLOS protein).
MELELGLAPPNSGHLVVDELSSSSSSGGGSGSAPVSASSAGKRGFREAFQETLLLFDDGS
CCNTSDDDCRRRKKTVVGWPPVSSARRACGGANYVKVKKEGDAIGRKVDLALHSSYDELA
ATLARMFPTNDHQGEKKMANDDHGDAAGPVVTYEDGDGDWMLVGDVPWDDFARSVKRLKI
LG*

5'UTR

chr02:34348582..34348728 (+ strand) : 147 bp

CDS

chr02:34348729..34349128 (+ strand) : 400 bp

chr02:34349263..34349368 (+ strand) : 106 bp

chr02:34349486..34349528 (+ strand) : 43 bp

3'UTR

chr02:34349529..34349843 (+ strand) : 315 bp

FASTA

>Os02t0805100-01 class=Sequence position=chr02:34348582..34349843 (+ strand)
AAAGTCATCG CCATCATCGA TCGATCGATC ACAACTACTA GAAATCCAGC CAAGAAGATC GAGACCGGAT ACAGCTAGCA
ATCCATCCAA GAAGATCGAG AGAGCGGATA CAGCTAGCCT AGCTACGCGA AGGATCAGAT CATCGGCATG GAGCTGGAGC
TTGGGCTGGC GCCACCGAAT TCCGGTCATC TCGTCGTCGA CGAGCTCAGC AGCAGCAGCA GCAGCGGCGG CGGCAGCGGC
AGCGCGCCGG TGTCTGCCTC GTCGGCCGGG AAGAGGGGAT TCAGGGAGGC GTTCCAGGAG ACGCTGCTGC TCTTCGACGA
CGGCAGCTGC TGCAACACCA GCGACGACGA TTGCAGGAGG AGGAAGAAGA CGGTGGTGGG GTGGCCACCG GTGAGCTCGG
CGCGGCGGGC GTGCGGCGGC GCCAACTACG TGAAGGTGAA GAAGGAAGGC GACGCCATCG GGAGGAAGGT TGATTTGGCC
CTCCATTCCT CCTACGACGA GCTCGCTGCC ACGCTCGCCC GCATGTTCCC CACCAACGAC CACCAAGGTC AGTAGCTAAT
TTAACTCAAC CCAATTGTTC ATCAGCACAT GTGATTACAA AAGCAAGCAG AATCTAGTAA CCGAATTCGA TTGCGATCAA
TGATTCTGAT GCTAGGTTTG GTTATCGTGA TATATTTACA GGCGAGAAGA AAATGGCCAA TGATGATCAT GGCGATGCCG
CTGGACCTGT GGTCACCTAC GAGGATGGTG ATGGGGATTG GATGCTGGTT GGGGACGTGC CATGGGAGTA AGTCGATTTC
AAGCTTAGTT ATTTCAGTGT TAGTATAACT TAATGAATCA GCAAGATTGA ACATTAGATT CTGTGTAATA CTGACATGTT
AATCCTTTGT TTTGTTTGTT GCAGTGATTT TGCACGATCT GTGAAACGCC TGAAGATACT GGGTTAACTG AACTGAAGGA
GATGCATGCG TGAGTTGATG GAGCACAGCT CGGTTTTGGT TGCCTGGCAT CTGCGTGTGG GTGTGCACTG ATGTATGTAC
ATGTTTTCGT TTTCAGTCAG GATGTTAGGA CGAGAGAAAG AGCTTTCTGT CAAAGACTAT ATACTGCTAG CTTATATATA
CTGTAGTTGG GCACATCTCA TGTGTGCCCA GGGCTAGGTT TTGAGAATGT TTACAGAGTT CTGTGTTTTT ACACCTTCTA
TATGTTTTGC AAACTGATCT TGTACTATAA TACTACTTTT ATTTATTTCT CTCTTTTTTT TC

Locus: Os02g0805100

Loading...

Locus: Os02g0805100

Loading...