Os02t0805250-01

Locus

Os02g0805250

Description

Basic helix-loop-helix transcription factor, Regulation of grain size

RAP-DB Gene Symbol Synonym(s)

OsbHLH107

RAP-DB Gene Name Synonym(s)

basic helix-loop-helix protein 107

CGSNL Gene Symbol

LGS1

CGSNL Gene Name

LARGER GRAIN SIZE 1

Oryzabase Gene Symbol Synonym(s)

OsbHLH107, bHLH107

Oryzabase Gene Name Synonym(s)

basic helix-loop-helix protein 107, larger grain size 1

Transcript Evidence

Inferred from literature

Protein Evidence

Inferred from literature

Literature

PMID: 30030651

Note

Manual Curation

July 23, 2018

Gene Ontology (GO)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

Helix-loop-helix DNA-binding domain superfamily (IPR036638)

Myc-type, basic helix-loop-helix (bHLH) domain (IPR011598)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Expression Databases

TENOR (Os02t0805250-00)

Others

Oryzabase (15388)

KEGG (Os02t0805250-00)

Transcript

1572 bp

>Os02t0805250-01 Basic helix-loop-helix transcription factor, Regulation of grain size
CATCAATGAACCTCTCCACCCCACCCCGCGACGCGACGCGACGAGCCGTACACCGACCGC
CCCGCGCCGCTGCTGCCGGAGCCGGAGAGAGAAGCTGAAGCCGAAGCAGAGGCAGCCGCA
GCGGCAAAACTCAAAAGACGTCGTCAAAAGCTCTGCCGCGCTTGCAGCTTTCTCGGGCTC
AAGGAAAAGCCATCACAAAACCAGAGACACAGAGAGAGAGAGAGAGAAACTGAAGAAAGG
TGGCAACTCCTGCAGCAGCTGCAGCAGCAAGCGCTAGTGTTTGTGGTTTGCTGGTGCTGT
GGCGAGGCGATGATGGATGGGCGAGGAAGCCAGGAGGAGGAGCACCTGGATTTGATCATG
CGACACCACGCCAGCATGGGGCTGGATCGCTGCGAGAGCGAGGAGGCGCTGGGGTCGTCG
GAGTCGGAGCAGCCCACCAGGCCGGCGCGGCCGCGCGGCAAGAGGAGCCGCGCCGCCGAG
GTGCACAACCTCTCCGAGAAGAGGAGGAGGAGCAGAATCAATGAGAAGATGAAGGCCCTG
CAGAGCCTCATTCCCAACTCCAGCAAGACGGACAAAGCCTCCATGCTTGACGATGCCATC
GAGTACCTGAAGCAGCTTCAGCTCCAGGTCCAGATGTTGTCCATGAGGAATGGTCTATAT
CTGCCCCCAGTGAACTTATCTGGGGCACCTGAGCATCTGCCGATCCCGCAAATGAGTGCT
GCACTTGACCAGAATAGTGCCAAAGCATCAGATCCTTCAGTTGTTTTGCAGCCGGTGAAC
CAGACTTCAGGAGCACTTCTTCCATTTGAGCTGGCAAGCCAACATAAACCTCTATTCTTA
CCAGGTGTTCCTAATGCAACCGCTCTGGAGCCTCGGTTCCTTGTAGAGTCTTCGCGTTCC
AATCTTCAATCCTTACGGTTCACTGAACCCGCTGAGATGATCTATCCTGATGAGATGATG
TTAAAGCACCGCCTGACTTCAGCTAGTGAGAGCACAATTGTGCCAGGAACCGATGAGAAG
TCGGTTAGGCAGAACACATACATGATGAATGCTGATCGTTTTGATAGATATGCACTCAGC
AAAGACCAGTTGCAGCACATTATGCCGAAAAACACAGAAAGTGTACTTGATATGCCACAC
TTGCAAAGATTATAAGCTGACGATTCAGCTTCCAATCTTGGACAGGTTGCAAACCAGTGA
CACCAAAGTTAGGGTCGAGGGCAGAATCAAAGTAAACCCATGATCTAATTTCCAATTGGA
CTTGTGGAGTGCAGAGCAGATCAAAATCGGTGACTGGTGATCATGAGCAGCACCTAATCT
AGCATTTTACCTCTAGAACAGTAGTTATATCTTGTTGTGCCATTGTACTCTGGTGTGAAG
TGCTTTGTAAAGGGAGATCTATCTATAAGCTGCCAGTAACAATGAACATATCCGATGTTA
GGAAATAGGAAAATACCATCAAATCAAATCTATATTGCCAATGTAGGCCGGAATTGGGAG
ATGTGAGATGCCTGTGGCCACTAATTGAGGCTGCATAGTTTGTCTCCACTGTTTTAAAAA
AAATCATTTTTC

CDS

846 bp

>Os02t0805250-01 Basic helix-loop-helix transcription factor, Regulation of grain size
ATGATGGATGGGCGAGGAAGCCAGGAGGAGGAGCACCTGGATTTGATCATGCGACACCAC
GCCAGCATGGGGCTGGATCGCTGCGAGAGCGAGGAGGCGCTGGGGTCGTCGGAGTCGGAG
CAGCCCACCAGGCCGGCGCGGCCGCGCGGCAAGAGGAGCCGCGCCGCCGAGGTGCACAAC
CTCTCCGAGAAGAGGAGGAGGAGCAGAATCAATGAGAAGATGAAGGCCCTGCAGAGCCTC
ATTCCCAACTCCAGCAAGACGGACAAAGCCTCCATGCTTGACGATGCCATCGAGTACCTG
AAGCAGCTTCAGCTCCAGGTCCAGATGTTGTCCATGAGGAATGGTCTATATCTGCCCCCA
GTGAACTTATCTGGGGCACCTGAGCATCTGCCGATCCCGCAAATGAGTGCTGCACTTGAC
CAGAATAGTGCCAAAGCATCAGATCCTTCAGTTGTTTTGCAGCCGGTGAACCAGACTTCA
GGAGCACTTCTTCCATTTGAGCTGGCAAGCCAACATAAACCTCTATTCTTACCAGGTGTT
CCTAATGCAACCGCTCTGGAGCCTCGGTTCCTTGTAGAGTCTTCGCGTTCCAATCTTCAA
TCCTTACGGTTCACTGAACCCGCTGAGATGATCTATCCTGATGAGATGATGTTAAAGCAC
CGCCTGACTTCAGCTAGTGAGAGCACAATTGTGCCAGGAACCGATGAGAAGTCGGTTAGG
CAGAACACATACATGATGAATGCTGATCGTTTTGATAGATATGCACTCAGCAAAGACCAG
TTGCAGCACATTATGCCGAAAAACACAGAAAGTGTACTTGATATGCCACACTTGCAAAGA
TTATAA

Protein

282 aa

>Os02t0805250-01 Basic helix-loop-helix transcription factor, Regulation of grain size
MMDGRGSQEEEHLDLIMRHHASMGLDRCESEEALGSSESEQPTRPARPRGKRSRAAEVHN
LSEKRRRSRINEKMKALQSLIPNSSKTDKASMLDDAIEYLKQLQLQVQMLSMRNGLYLPP
VNLSGAPEHLPIPQMSAALDQNSAKASDPSVVLQPVNQTSGALLPFELASQHKPLFLPGV
PNATALEPRFLVESSRSNLQSLRFTEPAEMIYPDEMMLKHRLTSASESTIVPGTDEKSVR
QNTYMMNADRFDRYALSKDQLQHIMPKNTESVLDMPHLQRL*

5'UTR

chr02:34356517..34356787 (- strand) : 271 bp

chr02:34356365..34356402 (- strand) : 38 bp

CDS

chr02:34356272..34356364 (- strand) : 93 bp

chr02:34356091..34356189 (- strand) : 99 bp

chr02:34355932..34355997 (- strand) : 66 bp

chr02:34355722..34355787 (- strand) : 66 bp

chr02:34355028..34355330 (- strand) : 303 bp

chr02:34354841..34354910 (- strand) : 70 bp

chr02:34354595..34354736 (- strand) : 142 bp

chr02:34354147..34354153 (- strand) : 7 bp

3'UTR

chr02:34353730..34354146 (- strand) : 417 bp

FASTA

>Os02t0805250-01 class=Sequence position=chr02:34353730..34356787 (- strand)
CATCAATGAA CCTCTCCACC CCACCCCGCG ACGCGACGCG ACGAGCCGTA CACCGACCGC CCCGCGCCGC TGCTGCCGGA
GCCGGAGAGA GAAGCTGAAG CCGAAGCAGA GGCAGCCGCA GCGGCAAAAC TCAAAAGACG TCGTCAAAAG CTCTGCCGCG
CTTGCAGCTT TCTCGGGCTC AAGGAAAAGC CATCACAAAA CCAGAGACAC AGAGAGAGAG AGAGAGAAAC TGAAGAAAGG
TGGCAACTCC TGCAGCAGCT GCAGCAGCAA GGTATGGGCA GCTCATGACC AGCAACAGCA GCAGCAGCGT CCAATTTCTC
GTGGCGCTCG CTCGCCATTT CTGGAGTACT TAAGGAGTTC TTGGTTTTGT TCGTTCGTCC GGTAGCGCTA GTGTTTGTGG
TTTGCTGGTG CTGTGGCGAG GCGATGATGG ATGGGCGAGG AAGCCAGGAG GAGGAGCACC TGGATTTGAT CATGCGACAC
CACGCCAGCA TGGGGCTGGA TCGCTGCGAG AGCGAGGTTG GCGTGCGGTG TCCGCGTTTG ATTCGATCGG ATGCTGGTGG
TGATTTGGCG GTTTGATTTG GTGTTTGGTT CTTTTTAGGA GGCGCTGGGG TCGTCGGAGT CGGAGCAGCC CACCAGGCCG
GCGCGGCCGC GCGGCAAGAG GAGCCGCGCC GCCGAGGTGC ACAACCTCTC CGAGAAGGTT AGCCCGGCGA CGGCGACTGC
TACCTCTCGT GTTCCTCTTG GTATCAGCTG ATTTTGTGGG ATTGATTTTG ACCACGGTAA TTTGGTGCAG AGGAGGAGGA
GCAGAATCAA TGAGAAGATG AAGGCCCTGC AGAGCCTCAT TCCCAACTCC AGCAAGGTAG TAAAAAAAAT TGTCTCTCTT
GTTTCTTACT CGATTTTTTG TTCAACGATT TATACACACT ATTACTTGTG TTGCTGGAAG CTAATCTCTC GAGTTAATTT
GGCGTTTATC TTGTGCTGAT GGTTTCATTC ACCGATGCAG ACGGACAAAG CCTCCATGCT TGACGATGCC ATCGAGTACC
TGAAGCAGCT TCAGCTCCAG GTCCAGGTAA GTGTAATGAA TGTTGCATTG TTACTGAATT GCTTGAGGAT TATTTTCGCA
AATCCACAGA CTTAATGCTC CAGGTATCGA CAATGGATAT GTCAAGCGTT TTGAATATTG AGCAGCTGTG TGCTGAAGTG
AAATGGTACT AGCATATATG AGTTAGGACA AGCTTGAAGT TCTAGCATCA AAAAGTGTAC ATTAGCTATC CTAATCACCA
TTTTCTGATG GCTTACTGTC TAAGCAAGAT TTAGTCGGTT AGGACGTCAG AAAAGAACAT TGATCTAATC ACAGCATGCC
ACATTGTTGT TTGCACGGCA TTTGTAAGAA AAACAAAATG TATGTATTCC ACGTTACTGC AGCTAATTTC TGTTTGATTG
CTGAATTTTT GTTCCAGATG TTGTCCATGA GGAATGGTCT ATATCTGCCC CCAGTGAACT TATCTGGGGC ACCTGAGCAT
CTGCCGATCC CGCAAATGAG TGCTGCACTT GACCAGAATA GTGCCAAAGC ATCAGATCCT TCAGTTGTTT TGCAGCCGGT
GAACCAGACT TCAGGAGCAC TTCTTCCATT TGAGCTGGCA AGCCAACATA AACCTCTATT CTTACCAGGT GTTCCTAATG
CAACCGCTCT GGAGCCTCGG TTCCTTGTAG AGTCTTCGCG TTCCAATCTT CAATCCTTAC GGTTCACTGA ACCCGCTGAG
GTAATCCTTT TTGTCTTGTA AGATCTTCAG CAGTCAGCAT ACTGAACCTC TTTCCTTGCT AATAGAATAG CACTTCATAT
GGTCATTTTT CACTTGTTGT ATCTATTTAT GTTGAAGATG ATCTATCCTG ATGAGATGAT GTTAAAGCAC CGCCTGACTT
CAGCTAGTGA GAGCACAATT GTGCCAGGTT AGAGAACATA AACTATTTCC AATAACCAAT AGTAGTTTCA GATTGCATTT
TTGGTGAACA TTTTTTTACA TTGACTGACC TTCCCTTTGC TTCTTCAATA GGAACCGATG AGAAGTCGGT TAGGCAGAAC
ACATACATGA TGAATGCTGA TCGTTTTGAT AGATATGCAC TCAGCAAAGA CCAGTTGCAG CACATTATGC CGAAAAACAC
AGAAAGTGTA CTTGATATGC CACACTTGCA AAGGTAAAAG CTTCTTTTGC CACTTATTTA TAGTATAATG AAAGTAGGCT
CCATTTTCCT TATAGATAGG ATTATTTCTT TATAGTACAC CATAATACTT TCCTGTGATC ATAAGCATAT TTTAAGGAAA
CTGGATTTGG ATGGCCTAAA GATTAGCGTG CGCCTATTTT ATCTTGTTTT TTCATTAACA TGTTTAGTAA TAAATGAATG
TCCCATAGCA GCAAGGTTTC TTGGTCTGAC TATCTTATTC TGAGAAATAG AGAAAGGACC CTAAAATTCA AGCTGTAGGT
AGATTAAACA GCAAGAACTA ACATAATTTT GCAAATTAGA CTATGCAACT GCAATTATTA GACTATGCAA AGAGCAAATT
TCACTTATTA AAACTAGTAA ATCAGTTTGT GACACTGTTC TCCAGAATTC TGACAAAGGT GTTAATTGTT TCAGATTATA
AGCTGACGAT TCAGCTTCCA ATCTTGGACA GGTTGCAAAC CAGTGACACC AAAGTTAGGG TCGAGGGCAG AATCAAAGTA
AACCCATGAT CTAATTTCCA ATTGGACTTG TGGAGTGCAG AGCAGATCAA AATCGGTGAC TGGTGATCAT GAGCAGCACC
TAATCTAGCA TTTTACCTCT AGAACAGTAG TTATATCTTG TTGTGCCATT GTACTCTGGT GTGAAGTGCT TTGTAAAGGG
AGATCTATCT ATAAGCTGCC AGTAACAATG AACATATCCG ATGTTAGGAA ATAGGAAAAT ACCATCAAAT CAAATCTATA
TTGCCAATGT AGGCCGGAAT TGGGAGATGT GAGATGCCTG TGGCCACTAA TTGAGGCTGC ATAGTTTGTC TCCACTGTTT
TAAAAAAAAT CATTTTTC

Locus: Os02g0805250

Loading...

Locus: Os02g0805250

Loading...