Os02t0806300-01

Locus

Os02g0806300

Description

Hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsGATA3, GATA3

Oryzabase Gene Name Synonym(s)

GATA transcription factor 3, GATA factor 3

Transcript Evidence

AK099828 (DDBJ, Best hit)

Protein Evidence

longestORF

Literature

Note

Manual Curation

Full-length cDNA

J013104B13 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0806300-01)

Others

Oryzabase (22165)

KEGG (Os02t0806300-01)

Transcript

1457 bp

>Os02t0806300-01 Hypothetical protein.
TTTTTTCTTCCTCCCATCCGCGTGTGCCGTGCAGGTCGTGTGCGAGCACCAGTGTAAAAG
GGAACGAGGAGTGGGAGTGGATCTCCACTCCGCCATAGCTTAGCTAGCCTCCAACGTTCA
AAACCCAGGAGCCATAGCCCAGCAAGCAGATACCACTTTTTTTTTTTTTTTTTGGTTTCG
TCTCCTCTCAAGTCCCAGCTGAAAGCCTGAAAGCTGTGCTGGTTTCTTACCTTCCCTCAC
GTTCTCACACCCATATTTAATCCTCCATTTTTATTATTTTTGAAATTTTTTTTGAGCTCT
GCCTGCAGCTTAACTCCTCCCCCAGTATATACATATACTAGTAGTACTACATACACCTCC
TCTTATAGCTCTAGAATTGAATTCCACCGACCCACGCACGCATCCTTTTTTCTCCATCCC
CCTCCTTCCGTTCTTCCATTTACCTCCACCTATATAGCACTCCGGAATTGCGCCATCTCT
CTGCCTTAGGAGTACAGTGAAGTGCTCTCCATATAATTGCAGTGGTGCAAGGCAGGCAGC
AACTTTCTTCTTCTTCCTCCTATCATAATCTGCTCATCCTTTTCCTCCTCTGGAGCAACC
ATGTCCATGCAGAAGGTGTACTAGATATATAGAGTTAGTTCGCAGCTGCTCCCTACTTAC
ATAAACAAACGCATTCAGATAGCCAGCTTCTTGATCGGCAACAGCAGCTAGTTAGAGTGC
AACAAGAGGTAGCAGAGACAATTTTTTTTGGCAAGGCAAGCAAAAGCTGATCGAGGAGAG
CGATCGAGCAGGTGTTGATCGATCGGTGCGAGGAAACAGAGACAATTTTCCCACACAGGT
GAGCTGAAAGCCTAGCTGCTCCTGCTGCATGTGATGTGTTCTTTCCCATTTCTCTCTCCC
CCCCCCCCCCCCCCCCCCGCAAAATCAGCCGCCGCCGCTTTCTTCAAATTCAAAAAAATG
GCAAGAAATGATCGGGAATTCAAAGGGGCTTTGCATTTTAAGTTGGCTTCCCGGTGGCGC
GCGGCCGTATTTCGCCGCGTCGCCAGCTTAATTCATTGCCATGCGTGTTTTTTTGCACGT
TCATTGCTTCATTCATCTTCCCCGGAAGGAAGACGAAAGGGGAGGAATATAGGAGGATGA
CGAAACTCGGAAGCCTCCGATTTGGACTCTTTCTCAATTTGAAGATTTCAAAATTTTCAA
ATCAATTCAAAAAAATCGAGAGTAAAATTACTAAAGGGAAGCTTCCGGCTACTAGATGGA
TAGAAAGTCATGGAAAAATTGGATGGGATTATCAGGGTTCACACGTCGGTACTACTGCTA
TTATTCCAAGCTTTTTCAACCGCGTCCCCCTGATTTTGTAGTACTTTTTTTTACAGTCTG
GATTATCTGGAAACATTTGGGGACAGTGAGAAAAAATGTGCAAATTCTGAGAGGCAATAC
GCCGGCAAGCAAGCAGT

CDS

267 bp

>Os02t0806300-01 Hypothetical protein.
ATGTGTTCTTTCCCATTTCTCTCTCCCCCCCCCCCCCCCCCCCCCGCAAAATCAGCCGCC
GCCGCTTTCTTCAAATTCAAAAAAATGGCAAGAAATGATCGGGAATTCAAAGGGGCTTTG
CATTTTAAGTTGGCTTCCCGGTGGCGCGCGGCCGTATTTCGCCGCGTCGCCAGCTTAATT
CATTGCCATGCGTGTTTTTTTGCACGTTCATTGCTTCATTCATCTTCCCCGGAAGGAAGA
CGAAAGGGGAGGAATATAGGAGGATGA

Protein

88 aa

>Os02t0806300-01 Hypothetical protein.
MCSFPFLSPPPPPPPAKSAAAAFFKFKKMARNDREFKGALHFKLASRWRAAVFRRVASLI
HCHACFFARSLLHSSSPEGRRKGRNIGG*

5'UTR

chr02:34408093..34408965 (+ strand) : 873 bp

CDS

chr02:34408966..34409232 (+ strand) : 267 bp

3'UTR

chr02:34409233..34409549 (+ strand) : 317 bp

FASTA

>Os02t0806300-01 class=Sequence position=chr02:34408093..34409549 (+ strand)
TTTTTTCTTC CTCCCATCCG CGTGTGCCGT GCAGGTCGTG TGCGAGCACC AGTGTAAAAG GGAACGAGGA GTGGGAGTGG
ATCTCCACTC CGCCATAGCT TAGCTAGCCT CCAACGTTCA AAACCCAGGA GCCATAGCCC AGCAAGCAGA TACCACTTTT
TTTTTTTTTT TTTGGTTTCG TCTCCTCTCA AGTCCCAGCT GAAAGCCTGA AAGCTGTGCT GGTTTCTTAC CTTCCCTCAC
GTTCTCACAC CCATATTTAA TCCTCCATTT TTATTATTTT TGAAATTTTT TTTGAGCTCT GCCTGCAGCT TAACTCCTCC
CCCAGTATAT ACATATACTA GTAGTACTAC ATACACCTCC TCTTATAGCT CTAGAATTGA ATTCCACCGA CCCACGCACG
CATCCTTTTT TCTCCATCCC CCTCCTTCCG TTCTTCCATT TACCTCCACC TATATAGCAC TCCGGAATTG CGCCATCTCT
CTGCCTTAGG AGTACAGTGA AGTGCTCTCC ATATAATTGC AGTGGTGCAA GGCAGGCAGC AACTTTCTTC TTCTTCCTCC
TATCATAATC TGCTCATCCT TTTCCTCCTC TGGAGCAACC ATGTCCATGC AGAAGGTGTA CTAGATATAT AGAGTTAGTT
CGCAGCTGCT CCCTACTTAC ATAAACAAAC GCATTCAGAT AGCCAGCTTC TTGATCGGCA ACAGCAGCTA GTTAGAGTGC
AACAAGAGGT AGCAGAGACA ATTTTTTTTG GCAAGGCAAG CAAAAGCTGA TCGAGGAGAG CGATCGAGCA GGTGTTGATC
GATCGGTGCG AGGAAACAGA GACAATTTTC CCACACAGGT GAGCTGAAAG CCTAGCTGCT CCTGCTGCAT GTGATGTGTT
CTTTCCCATT TCTCTCTCCC CCCCCCCCCC CCCCCCCCGC AAAATCAGCC GCCGCCGCTT TCTTCAAATT CAAAAAAATG
GCAAGAAATG ATCGGGAATT CAAAGGGGCT TTGCATTTTA AGTTGGCTTC CCGGTGGCGC GCGGCCGTAT TTCGCCGCGT
CGCCAGCTTA ATTCATTGCC ATGCGTGTTT TTTTGCACGT TCATTGCTTC ATTCATCTTC CCCGGAAGGA AGACGAAAGG
GGAGGAATAT AGGAGGATGA CGAAACTCGG AAGCCTCCGA TTTGGACTCT TTCTCAATTT GAAGATTTCA AAATTTTCAA
ATCAATTCAA AAAAATCGAG AGTAAAATTA CTAAAGGGAA GCTTCCGGCT ACTAGATGGA TAGAAAGTCA TGGAAAAATT
GGATGGGATT ATCAGGGTTC ACACGTCGGT ACTACTGCTA TTATTCCAAG CTTTTTCAAC CGCGTCCCCC TGATTTTGTA
GTACTTTTTT TTACAGTCTG GATTATCTGG AAACATTTGG GGACAGTGAG AAAAAATGTG CAAATTCTGA GAGGCAATAC
GCCGGCAAGC AAGCAGT

Locus: Os02g0806300

Loading...

Locus: Os02g0806300

Loading...