Os02t0808800-01

Locus

Os02g0808800

Description

Similar to Cinnamoyl-CoA reductase (EC 1.2.1.44).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CCR1

CGSNL Gene Name

CINNAMOYL-COA REDUCTASE 1

Oryzabase Gene Symbol Synonym(s)

OsCCR1

Oryzabase Gene Name Synonym(s)

OsCINNAMOYL-COENZYME A REDUCTASE1, CINNAMOYL-COENZYME A REDUCTASE 1, CINNAMOYL-CoA REDUCTASE 1

Transcript Evidence

AK064401 (DDBJ, Best hit)

Protein Evidence

Q8VXA7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cellular metabolic process (GO:0044237)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: coenzyme binding (GO:0050662)

Functional domain (InterPro)

NAD-dependent epimerase/dehydratase (IPR001509)

NAD(P)-binding domain (IPR016040)

Full-length cDNA

002-108-H04 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0808800-01)

RiceXPro (AK064401)

Others

Oryzabase (7100)

KEGG (Os02t0808800-01 (EC:1.2.1.44))

Transcript

1428 bp

>Os02t0808800-01 Similar to Cinnamoyl-CoA reductase (EC 1.2.1.44).
ACACCAACATACGGAGTTCGAGTGACATACGAGCAGCAGCCAACACAAGCTCGATCGAAA
GTTCTCTCACAAGTTCAGAGTAGCATTTGGTTAGTGACAGTAACTGGTCAGCGTCTCTCA
CCATGTCGTCCAATTTTGAGGCCAACAACAACAACAATGGCGAGAAGCAGCTGGTCTGTG
TGACCGGAGCAGGTGGCTTCATTGGGTCGTGGGTGGTGAAGGAGCTCCTCATCCGTGGCT
ACCACGTCAGGGGAACAGCCAGGGATCCTGCTGACAGCAAGAATGCTCACCTGCTTGAGC
TGGAGGGAGCCGACGAGAGGCTCTCCCTCTGCCGCGCCGACGTCCTCGACGCCGCCAGCC
TCCGCGCCGCCTTCAGCGGGTGCCACGGCGTCTTCCATGTCGCCTCCCCGGTGTCTAACG
ACCCTGACCTTGTTCCGGTTGCAGTGGAGGGGACGAGGAACGTGATCAACGCAGCGGCGG
ACATGGGCGTGCGCCGCGTGGTGTTCACGTCGTCGTACGGCGCCGTGCACATGAACCCCA
ACCGGAGCCCCGACGCCGTCCTCGACGAGACCTGCTGGAGCGACTACGAATTCTGCAAGC
AAACAGACAACCTGTACTGCTGCGCCAAGATGATGGCGGAGATGACGGCGACGGAGGAGG
CGGCGAAGAGGGGGCTGGAGCTGGCGGTGGTGGTGCCGTCGATGACGATGGGTCCCATGC
TTCAGCAGACGCTCAACTTCAGCACCAACCACGTCGCCCGCTACCTCATGGGCACCAAGA
AGTCCTACCCCAACGCCGTCGCGGCCTACGTCGACGTCCGCGACGTCGCCCGCGCACACG
TCCTCGTCTACGAGCGCCCCGAGGCACGCGGCCGCTACCTCTGCATCGGCACCGTGCTCC
ACCGCGCCGAGCTCCTCCGGATGCTCAGGGAGCTCTTCCCACGGTACCCTGCCACTGCAA
AGTGTGAGGATGATGGGAAGCCGATGGCGAAGCCGTATAAGTTCTCGAACCAGAGGCTCA
AGGATTTGGGTTTGGAGTTCACTCCACTGAGGAAGAGTTTGAATGAGGCGGTCCTATGCA
TGCAGCAGAAGGGTCACCTGCCTCTGATTTATCCCGTTCCAAAACGTGCTTACCTATAAA
ATCAAGATAAAAATACGAATTCGTCTGTTGCGATGGGAAACAGAGAGCAACAGGGAAAAA
ACAAAGGAAAAAAAAGGAAACACAAGGGCTCTGAGATTGTTTATTTGTGCAAGTGTAGTA
GGCATTTATATTTTGTTCTTACACATGTAAAACCCTTCTGTAATGAACAATAAGGTCCCA
TGGAGGGAACGGCAAATGCAAATATGGCCTTCATTTGTATTCTGGGCTTCAGGATGTAAA
TTTGAATATCATTGTATTTATTTTCTATGTTGCAGGGAATTTCCGAGT

CDS

1017 bp

>Os02t0808800-01 Similar to Cinnamoyl-CoA reductase (EC 1.2.1.44).
ATGTCGTCCAATTTTGAGGCCAACAACAACAACAATGGCGAGAAGCAGCTGGTCTGTGTG
ACCGGAGCAGGTGGCTTCATTGGGTCGTGGGTGGTGAAGGAGCTCCTCATCCGTGGCTAC
CACGTCAGGGGAACAGCCAGGGATCCTGCTGACAGCAAGAATGCTCACCTGCTTGAGCTG
GAGGGAGCCGACGAGAGGCTCTCCCTCTGCCGCGCCGACGTCCTCGACGCCGCCAGCCTC
CGCGCCGCCTTCAGCGGGTGCCACGGCGTCTTCCATGTCGCCTCCCCGGTGTCTAACGAC
CCTGACCTTGTTCCGGTTGCAGTGGAGGGGACGAGGAACGTGATCAACGCAGCGGCGGAC
ATGGGCGTGCGCCGCGTGGTGTTCACGTCGTCGTACGGCGCCGTGCACATGAACCCCAAC
CGGAGCCCCGACGCCGTCCTCGACGAGACCTGCTGGAGCGACTACGAATTCTGCAAGCAA
ACAGACAACCTGTACTGCTGCGCCAAGATGATGGCGGAGATGACGGCGACGGAGGAGGCG
GCGAAGAGGGGGCTGGAGCTGGCGGTGGTGGTGCCGTCGATGACGATGGGTCCCATGCTT
CAGCAGACGCTCAACTTCAGCACCAACCACGTCGCCCGCTACCTCATGGGCACCAAGAAG
TCCTACCCCAACGCCGTCGCGGCCTACGTCGACGTCCGCGACGTCGCCCGCGCACACGTC
CTCGTCTACGAGCGCCCCGAGGCACGCGGCCGCTACCTCTGCATCGGCACCGTGCTCCAC
CGCGCCGAGCTCCTCCGGATGCTCAGGGAGCTCTTCCCACGGTACCCTGCCACTGCAAAG
TGTGAGGATGATGGGAAGCCGATGGCGAAGCCGTATAAGTTCTCGAACCAGAGGCTCAAG
GATTTGGGTTTGGAGTTCACTCCACTGAGGAAGAGTTTGAATGAGGCGGTCCTATGCATG
CAGCAGAAGGGTCACCTGCCTCTGATTTATCCCGTTCCAAAACGTGCTTACCTATAA

Protein

339 aa

>Os02t0808800-01 Similar to Cinnamoyl-CoA reductase (EC 1.2.1.44).
MSSNFEANNNNNGEKQLVCVTGAGGFIGSWVVKELLIRGYHVRGTARDPADSKNAHLLEL
EGADERLSLCRADVLDAASLRAAFSGCHGVFHVASPVSNDPDLVPVAVEGTRNVINAAAD
MGVRRVVFTSSYGAVHMNPNRSPDAVLDETCWSDYEFCKQTDNLYCCAKMMAEMTATEEA
AKRGLELAVVVPSMTMGPMLQQTLNFSTNHVARYLMGTKKSYPNAVAAYVDVRDVARAHV
LVYERPEARGRYLCIGTVLHRAELLRMLRELFPRYPATAKCEDDGKPMAKPYKFSNQRLK
DLGLEFTPLRKSLNEAVLCMQQKGHLPLIYPVPKRAYL*

5'UTR

chr02:34566001..34566122 (- strand) : 122 bp

CDS

chr02:34565853..34566000 (- strand) : 148 bp

chr02:34565603..34565757 (- strand) : 155 bp

chr02:34565327..34565509 (- strand) : 183 bp

chr02:34564870..34565222 (- strand) : 353 bp

chr02:34564579..34564756 (- strand) : 178 bp

3'UTR

chr02:34564290..34564578 (- strand) : 289 bp

FASTA

>Os02t0808800-01 class=Sequence position=chr02:34564290..34566122 (- strand)
ACACCAACAT ACGGAGTTCG AGTGACATAC GAGCAGCAGC CAACACAAGC TCGATCGAAA GTTCTCTCAC AAGTTCAGAG
TAGCATTTGG TTAGTGACAG TAACTGGTCA GCGTCTCTCA CCATGTCGTC CAATTTTGAG GCCAACAACA ACAACAATGG
CGAGAAGCAG CTGGTCTGTG TGACCGGAGC AGGTGGCTTC ATTGGGTCGT GGGTGGTGAA GGAGCTCCTC ATCCGTGGCT
ACCACGTCAG GGGAACAGCC AGGGATCCTG GTAAGTACTA GTACTATTAG TTCACGGTGT TTGCATAAAT TTGGTGCGTG
TTGTGCTTGA TTTATTGATC GGTTCTTGCA TGCGCGTATC TGTAGCTGAC AGCAAGAATG CTCACCTGCT TGAGCTGGAG
GGAGCCGACG AGAGGCTCTC CCTCTGCCGC GCCGACGTCC TCGACGCCGC CAGCCTCCGC GCCGCCTTCA GCGGGTGCCA
CGGCGTCTTC CATGTCGCCT CCCCGGTGTC TAACGACCCT GTAAGTTCAC TAGCCTGGTT CCTGAGCCCA AAAGAGACGA
CAATGGCACC TTTAACCTCC TCCAACTTTT ACTAATGCTG CTCCGTGATG CAGGACCTTG TTCCGGTTGC AGTGGAGGGG
ACGAGGAACG TGATCAACGC AGCGGCGGAC ATGGGCGTGC GCCGCGTGGT GTTCACGTCG TCGTACGGCG CCGTGCACAT
GAACCCCAAC CGGAGCCCCG ACGCCGTCCT CGACGAGACC TGCTGGAGCG ACTACGAATT CTGCAAGCAA ACAGACGTAA
GCACATTACT CTGCTCCGTT CTACGGTTCT ACCAACTCCA ACAGCGTTGC TTACATGAAC AATAAATTCA TCTCGGCAAA
TTTTCTCGTC GTACATGCAG AACCTGTACT GCTGCGCCAA GATGATGGCG GAGATGACGG CGACGGAGGA GGCGGCGAAG
AGGGGGCTGG AGCTGGCGGT GGTGGTGCCG TCGATGACGA TGGGTCCCAT GCTTCAGCAG ACGCTCAACT TCAGCACCAA
CCACGTCGCC CGCTACCTCA TGGGCACCAA GAAGTCCTAC CCCAACGCCG TCGCGGCCTA CGTCGACGTC CGCGACGTCG
CCCGCGCACA CGTCCTCGTC TACGAGCGCC CCGAGGCACG CGGCCGCTAC CTCTGCATCG GCACCGTGCT CCACCGCGCC
GAGCTCCTCC GGATGCTCAG GGAGCTCTTC CCACGGTACC CTGCCACTGC AAAGTATGCA GATATTAGCC ATTGATTTGC
TTATGTGCAT TGCTTCATTG CTCTTGTGAG ATGCAATCGA TCGATCTCAA ATTCTCATGC GTGTGTTTCT TGGATTTTTT
TTTCAGGTGT GAGGATGATG GGAAGCCGAT GGCGAAGCCG TATAAGTTCT CGAACCAGAG GCTCAAGGAT TTGGGTTTGG
AGTTCACTCC ACTGAGGAAG AGTTTGAATG AGGCGGTCCT ATGCATGCAG CAGAAGGGTC ACCTGCCTCT GATTTATCCC
GTTCCAAAAC GTGCTTACCT ATAAAATCAA GATAAAAATA CGAATTCGTC TGTTGCGATG GGAAACAGAG AGCAACAGGG
AAAAAACAAA GGAAAAAAAA GGAAACACAA GGGCTCTGAG ATTGTTTATT TGTGCAAGTG TAGTAGGCAT TTATATTTTG
TTCTTACACA TGTAAAACCC TTCTGTAATG AACAATAAGG TCCCATGGAG GGAACGGCAA ATGCAAATAT GGCCTTCATT
TGTATTCTGG GCTTCAGGAT GTAAATTTGA ATATCATTGT ATTTATTTTC TATGTTGCAG GGAATTTCCG AGT

Locus: Os02g0808800

Loading...

Locus: Os02g0808800

Loading...