Os02t0810900-01

Locus

Os02g0810900

Description

Similar to NAC-domain containing protein 21/22 (ANAC021) (ANAC022). Splice isoform 2.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC32

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 32

Oryzabase Gene Symbol Synonym(s)

ONAC032, ONAC32, ONAC056, ONAC56

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 032, NAC domain-containing protein 32, NAC domain-containing protein 56

Transcript Evidence

AK070982 (DDBJ, Best hit)

Protein Evidence

C3PU45 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

J023075A01 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0810900-01)

RiceXPro (AK070982)

Others

Oryzabase (11477)

KEGG (Os02t0810900-01)

Transcript

1530 bp

>Os02t0810900-01 Similar to NAC-domain containing protein 21/22 (ANAC021) (ANAC022). Splice isoform 2.
ACACAATCGCCAACCTATACAGATATATGTGCTAGCTACTTCCAAGTTCCTACCTATCAA
TTTCTCTCCTCCTCTTCTTCTTCTCTGCATCAATCTGCAGCTTAATTCTTAGCTATGTAC
ATATAGCTAGCTACCACTTCCAAAATACTCCACAGAGATCAATCACATATAGATATAGCT
AGATTGCTATAGACAGAGAGATCATCAAAGAAATTTAGCAGGTGATAGCCACATGGGGTT
GAGGGACATCGAGCTGACGCtgcctccggggttccggttctacccgagcgacgaggagct
tgtctgccactaccttcataacaaggtggtgaaccagcatcgcttcgccggagttggagg
agccgccgccgccggcggcggcaccatggtcgaggtggacctccacacccacgagccgtg
ggagctaccagatgtggcgaagctgagcacgaacgagtggtacttcttcagcttccgcga
ccgcaagtacgcgacggggctccgcacgaaccgcgccaccaagtccggctactggaaggc
caccggcaaggaccgcgtcatccacaaccccaagctgcacgccgccgcccaccgccgcgc
ctccatcgtcggcatgcgcaagacccttgtcttctaccgcggccgcgcccccaacggcgt
caaaaccaactgggtcatgcacgaatttcgcatggaaaaccctcacaccccTCCCAAGGA
GGATTGGGTGTTGTGCAGAGTGTTCTACAAGAAGAAGGCGGAGACGGAGACGGAGTCGTC
GTACAGCATGGAGAACGAGCAGGAGGCGGTGATCGCCATGGCACGGAGCGCCGCGGCCAT
CAAGGCGGGTGGATGCTACTCCAACTCCTCCTCGTCTCACGACCCAGCCGCCGCCGGCCA
TCACTCGCCCCCGCCATTCCCGGCGTCGCTCGCCGCCTGCAGCAGCAGCCACCACTACAG
CAGCCACCCACCGCCGCCTCCCGATCACCACCACCACCACCACATGCCCGTCACCGGCGG
CGGCGGCGGCTCCCTCAACGAGTTCATCCCCACCACCAGCATGGCGCTGTACAGCAGCAT
CTTCGACTTCAGCCAGCATCTCGACGGCGGCGCCGTGGCGGCGTCGGCGTCGGCGGCGGG
ATCGAGGGTCGACGGCGGCGAGCAGTGCGGTCTGATGGAGCTAGGGCTCGAGGAGCACTA
CAATTACAACGGCCTGATGCCGATGTGACGATCCACCATAGGTGTCGGTGCTGCTAGTGC
TAGCTTAGCTAGCTTACACACACTCCCAGCTGCTAGCTAGCTGCAGTTCTGCAGCGCAGC
TAGCTAGCGTTTATTATTAATAACCTCTTTTCACCTCGATTGTTTGATCTGATTTGTTTC
GTGGTGATCGATTCCATCGATCAGCTTGTGCAGATTTCGTTGATTGTGCATGCAAACATG
CGCACCTGTGTATAGGGTATAGTGGTACGTCGTATAGCGCTGTTGCATTGTTTGGAGGTA
AATTATATATCTTAGCCTTTAATTTGATTG

CDS

996 bp

>Os02t0810900-01 Similar to NAC-domain containing protein 21/22 (ANAC021) (ANAC022). Splice isoform 2.
ATGGGGTTGAGGGACATCGAGCTGACGCtgcctccggggttccggttctacccgagcgac
gaggagcttgtctgccactaccttcataacaaggtggtgaaccagcatcgcttcgccgga
gttggaggagccgccgccgccggcggcggcaccatggtcgaggtggacctccacacccac
gagccgtgggagctaccagatgtggcgaagctgagcacgaacgagtggtacttcttcagc
ttccgcgaccgcaagtacgcgacggggctccgcacgaaccgcgccaccaagtccggctac
tggaaggccaccggcaaggaccgcgtcatccacaaccccaagctgcacgccgccgcccac
cgccgcgcctccatcgtcggcatgcgcaagacccttgtcttctaccgcggccgcgccccc
aacggcgtcaaaaccaactgggtcatgcacgaatttcgcatggaaaaccctcacaccccT
CCCAAGGAGGATTGGGTGTTGTGCAGAGTGTTCTACAAGAAGAAGGCGGAGACGGAGACG
GAGTCGTCGTACAGCATGGAGAACGAGCAGGAGGCGGTGATCGCCATGGCACGGAGCGCC
GCGGCCATCAAGGCGGGTGGATGCTACTCCAACTCCTCCTCGTCTCACGACCCAGCCGCC
GCCGGCCATCACTCGCCCCCGCCATTCCCGGCGTCGCTCGCCGCCTGCAGCAGCAGCCAC
CACTACAGCAGCCACCCACCGCCGCCTCCCGATCACCACCACCACCACCACATGCCCGTC
ACCGGCGGCGGCGGCGGCTCCCTCAACGAGTTCATCCCCACCACCAGCATGGCGCTGTAC
AGCAGCATCTTCGACTTCAGCCAGCATCTCGACGGCGGCGCCGTGGCGGCGTCGGCGTCG
GCGGCGGGATCGAGGGTCGACGGCGGCGAGCAGTGCGGTCTGATGGAGCTAGGGCTCGAG
GAGCACTACAATTACAACGGCCTGATGCCGATGTGA

Protein

332 aa

>Os02t0810900-01 Similar to NAC-domain containing protein 21/22 (ANAC021) (ANAC022). Splice isoform 2.
MGLRDIELTLPPGFRFYPSDEELVCHYLHNKVVNQHRFAGVGGAAAAGGGTMVEVDLHTH
EPWELPDVAKLSTNEWYFFSFRDRKYATGLRTNRATKSGYWKATGKDRVIHNPKLHAAAH
RRASIVGMRKTLVFYRGRAPNGVKTNWVMHEFRMENPHTPPKEDWVLCRVFYKKKAETET
ESSYSMENEQEAVIAMARSAAAIKAGGCYSNSSSSHDPAAAGHHSPPPFPASLAACSSSH
HYSSHPPPPPDHHHHHHMPVTGGGGGSLNEFIPTTSMALYSSIFDFSQHLDGGAVAASAS
AAGSRVDGGEQCGLMELGLEEHYNYNGLMPM*

5'UTR

chr02:34673360..34673591 (+ strand) : 232 bp

CDS

chr02:34673592..34673790 (+ strand) : 199 bp

chr02:34674843..34675129 (+ strand) : 287 bp

chr02:34675502..34676011 (+ strand) : 510 bp

3'UTR

chr02:34676012..34676313 (+ strand) : 302 bp

FASTA

>Os02t0810900-01 class=Sequence position=chr02:34673360..34676313 (+ strand)
ACACAATCGC CAACCTATAC AGATATATGT GCTAGCTACT TCCAAGTTCC TACCTATCAA TTTCTCTCCT CCTCTTCTTC
TTCTCTGCAT CAATCTGCAG CTTAATTCTT AGCTATGTAC ATATAGCTAG CTACCACTTC CAAAATACTC CACAGAGATC
AATCACATAT AGATATAGCT AGATTGCTAT AGACAGAGAG ATCATCAAAG AAATTTAGCA GGTGATAGCC ACATGGGGTT
GAGGGACATC GAGCTGACGC tgcctccggg gttccggttc tacccgagcg acgaggagct tgtctgccac taccttcata
acaaggtggt gaaccagcat cgcttcgccg gagttggagg agccgccgcc gccggcggcg gcaccatggt cgaggtggac
ctccacaccc acgagccgtg ggagctacca ggtaatcaCT TACTCAATCA AAATTAATTA ATTAATTACT ACTCCTTTTT
CCTCTCCCAC AAGCGACCCT CTCACtagct ccaaatcatt tatagctaat gtaatagtca attcatacaa tagttgctta
ctgtactatt aatacctggt cctacctgtc atacacatat tacgtcttag agtccgtgct acagctgact atatacctat
agtctcctgc tcttctctct cttcctttat ctttttaaaa tatgtttata gctggcttat agcttgctat tgtacctgct
cTTAGCCACG CGCCCTCTCT CTCCCCTCTT CTGCATGATT ATGGTTAATT AAATCGTAGA TGGTTCCTCC GTTTCCATGG
AATGATTAAT TACGCACGCA ACCACGCTTT ATTGGCTCCA ATTAGGATTG TCGTTATTCT TCCCCCTTGT TAATTAACCA
ACAAGGCACG GGTCGATCCA TCACGTATAT CTCTGTGCGC GTATGTGCaa cagtgtgtta tatattgctt ctggtgcaag
catacatata cctatatcta taatttattt ctttatgact gcaAGTGGGC TATCTAAGCT CTAGCTATAG CTTGTTCTCT
TTGTCTCTTA CGATTACGAT CAAATTTCCC ATCAATTTTT ATACATGTTT AAAATTTAAC TTATTTCATT CCATATCAAC
ATTTTCTTCA GGACATACTA CTATATGTGT GCATAAACTC TCCTTAATTT CCCCGCGCGC CGGCCCATCC TATTCTCAAA
AAAAAAAAAA CTGAGAACAA TAAAAATATA CATAATATTG AAAAAGATTA AATTAACCGG TTTGTTTAAT TTCCCTCAAT
CAAATCGATC TGCTTTCCAA AATTTCTGAA TAATTAACGG TATTTCTTTA CAAAACTGCA GGAACAAGTT TAATCAGAAT
CATATCGAAC AATTAATCAA GTAGCTAGTA TTATACCACA TACTGAATAT ATTACGGTTG ATCTCAGATT AGTCTAGATT
AATCGAGTTG TGATGTGAAA AATTAattat ggtgtgcatg cagatgtggc gaagctgagc acgaacgagt ggtacttctt
cagcttccgc gaccgcaagt acgcgacggg gctccgcacg aaccgcgcca ccaagtccgg ctactggaag gccaccggca
aggaccgcgt catccacaac cccaagctgc acgccgccgc ccaccgccgc gcctccatcg tcggcatgcg caagaccctt
gtcttctacc gcggccgcgc ccccaacggc gtcaaaacca actgggtcat gcacgaattt cgcatggaaa accctcacac
cccTCCCAAG GTTAGTCCTC ACAATCCAAC TAATTTCTCC AATAATTTCC TTACTCCTTT CATCCTCAAA TAAATAAAAT
CCAGCACGGG TTATGGTAAG ACCTGTTTag tcaaactgtt ttaagtttaa ccaagtttgt agaaaaaata ataatatttt
taacccatga caaatttatt aagaaaatta attcaattat tgatttgata aactaattta gtatcataaa tattactata
tttatctata aaattagtta aacttgaaat agtttgactt tATTAGAGTT AAAACGTGTT ATAACCTGAA GGAGTATAGT
AGTAACTTTT GGTTAATCAA GAGCTTGAGT TTGTGTGTTT AATTTTGCAT ATGTGTATGC AGGAGGATTG GGTGTTGTGC
AGAGTGTTCT ACAAGAAGAA GGCGGAGACG GAGACGGAGT CGTCGTACAG CATGGAGAAC GAGCAGGAGG CGGTGATCGC
CATGGCACGG AGCGCCGCGG CCATCAAGGC GGGTGGATGC TACTCCAACT CCTCCTCGTC TCACGACCCA GCCGCCGCCG
GCCATCACTC GCCCCCGCCA TTCCCGGCGT CGCTCGCCGC CTGCAGCAGC AGCCACCACT ACAGCAGCCA CCCACCGCCG
CCTCCCGATC ACCACCACCA CCACCACATG CCCGTCACCG GCGGCGGCGG CGGCTCCCTC AACGAGTTCA TCCCCACCAC
CAGCATGGCG CTGTACAGCA GCATCTTCGA CTTCAGCCAG CATCTCGACG GCGGCGCCGT GGCGGCGTCG GCGTCGGCGG
CGGGATCGAG GGTCGACGGC GGCGAGCAGT GCGGTCTGAT GGAGCTAGGG CTCGAGGAGC ACTACAATTA CAACGGCCTG
ATGCCGATGT GACGATCCAC CATAGGTGTC GGTGCTGCTA GTGCTAGCTT AGCTAGCTTA CACACACTCC CAGCTGCTAG
CTAGCTGCAG TTCTGCAGCG CAGCTAGCTA GCGTTTATTA TTAATAACCT CTTTTCACCT CGATTGTTTG ATCTGATTTG
TTTCGTGGTG ATCGATTCCA TCGATCAGCT TGTGCAGATT TCGTTGATTG TGCATGCAAA CATGCGCACC TGTGTATAGG
GTATAGTGGT ACGTCGTATA GCGCTGTTGC ATTGTTTGGA GGTAAATTAT ATATCTTAGC CTTTAATTTG ATTG

Locus: Os02g0810900

Loading...

Locus: Os02g0810900

Loading...