Os02t0810900-02

Locus

Os02g0810900

Description

Similar to NAC-domain containing protein 21/22 (ANAC021) (ANAC022). Splice isoform 2.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC32

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 32

Oryzabase Gene Symbol Synonym(s)

ONAC032, ONAC32, ONAC056, ONAC56

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 032, NAC domain-containing protein 32, NAC domain-containing protein 56

Transcript Evidence

AK060976 (DDBJ, Best hit)

Protein Evidence

C3PU45 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

006-202-E09 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0810900-02)

RiceXPro (AK060976)

Others

Oryzabase (11477)

KEGG (Os02t0810900-02)

Transcript

1400 bp

>Os02t0810900-02 Similar to NAC-domain containing protein 21/22 (ANAC021) (ANAC022). Splice isoform 2.
CTAGCTACCACTTCCAAAATACTCCACAGAGATCAATCACATATAGATATAGCTAGATTG
CTATAGACAGAGAGATCATCAAAGAAATTTAGCAGGTGATAGCCACATGGGGTTGAGGGA
CATCGAGCTGACGCtgcctccggggttccggttctacccgagcgacgaggagcttgtctg
ccactaccttcataacaaggtggtgaaccagcatcgcttcgccggagttggaggagccgc
cgccgccggcggcggcaccatggtcgaggtggacctccacacccacgagccgtgggagct
accagatgtggcgaagctgagcacgaacgagtggtacttcttcagcttccgcgaccgcaa
gtacgcgacggggctccgcacgaaccgcgccaccaagtccggctactggaaggccaccgg
caaggaccgcgtcatccacaaccccaagctgcacgccgccgcccaccgccgcgcctccat
cgtcggcatgcgcaagacccttgtcttctaccgcggccgcgcccccaacggcgtcaaaac
caactgggtcatgcacgaatttcgcatggaaaaccctcacaccccTCCCAAGGAGGATTG
GGTGTTGTGCAGAGTGTTCTACAAGAAGAAGGCGGAGACGGAGACGGAGTCGTCGTACAG
CATGGAGAACGAGCAGGAGGCGGTGATCGCCATGGCACGGAGCGCCGCGGCCATCAAGGC
GGGTGGATGCTACTCCAACTCCTCCTCGTCTCACGACCCAGCCGCCGCCGGCCATCACTC
GCCCCCGCCATTCCCGGCGTCGCTCGCCGCCTGCAGCAGCAGCCACCACTACAGCAGCCA
CCCACCGCCGCCTCCCGATCACCACCACCACCACCACATGCCCGTCACCGGCGGCGGCGG
CGGCTCCCTCAACGAGTTCATCCCCACCACCAGCATGGCGCTGTACAGCAGCATCTTCGA
CTTCAGCCAGCATCTCGACGGCGGCGCCGTGGCGGCGTCGGCGTCGGCGGCGGGATCGAG
GGTCGACGGCGGCGAGCAGTGCGGTCTGATGGAGCTAGGGCTCGAGGAGCACTACAATTA
CAACGGCCTGATGCCGATGTGACGATCCACCATAGGTGTCGGTGCTGCTAGTGCTAGCTT
AGCTAGCTTACACACACTCCCAGCTGCTAGCTAGCTGCAGTTCTGCAGCGCAGCTAGCTA
GCGTTTATTATTAATAACCTCTTTTCACCTCGATTGTTTGATCTGATTTGTTTCGTGGTG
ATCGATTCCATCGATCAGCTTGTGCAGATTTCGTTGATTGTGCATGCAAACATGCGCACC
TGTGTATAGGGTATAGTGGTACGTCGTATAGCGCTGTTGCATTGTTTGGAGGTAAATTAT
ATATCTTAGCCTTTAATTTG

CDS

996 bp

>Os02t0810900-02 Similar to NAC-domain containing protein 21/22 (ANAC021) (ANAC022). Splice isoform 2.
ATGGGGTTGAGGGACATCGAGCTGACGCtgcctccggggttccggttctacccgagcgac
gaggagcttgtctgccactaccttcataacaaggtggtgaaccagcatcgcttcgccgga
gttggaggagccgccgccgccggcggcggcaccatggtcgaggtggacctccacacccac
gagccgtgggagctaccagatgtggcgaagctgagcacgaacgagtggtacttcttcagc
ttccgcgaccgcaagtacgcgacggggctccgcacgaaccgcgccaccaagtccggctac
tggaaggccaccggcaaggaccgcgtcatccacaaccccaagctgcacgccgccgcccac
cgccgcgcctccatcgtcggcatgcgcaagacccttgtcttctaccgcggccgcgccccc
aacggcgtcaaaaccaactgggtcatgcacgaatttcgcatggaaaaccctcacaccccT
CCCAAGGAGGATTGGGTGTTGTGCAGAGTGTTCTACAAGAAGAAGGCGGAGACGGAGACG
GAGTCGTCGTACAGCATGGAGAACGAGCAGGAGGCGGTGATCGCCATGGCACGGAGCGCC
GCGGCCATCAAGGCGGGTGGATGCTACTCCAACTCCTCCTCGTCTCACGACCCAGCCGCC
GCCGGCCATCACTCGCCCCCGCCATTCCCGGCGTCGCTCGCCGCCTGCAGCAGCAGCCAC
CACTACAGCAGCCACCCACCGCCGCCTCCCGATCACCACCACCACCACCACATGCCCGTC
ACCGGCGGCGGCGGCGGCTCCCTCAACGAGTTCATCCCCACCACCAGCATGGCGCTGTAC
AGCAGCATCTTCGACTTCAGCCAGCATCTCGACGGCGGCGCCGTGGCGGCGTCGGCGTCG
GCGGCGGGATCGAGGGTCGACGGCGGCGAGCAGTGCGGTCTGATGGAGCTAGGGCTCGAG
GAGCACTACAATTACAACGGCCTGATGCCGATGTGA

Protein

332 aa

>Os02t0810900-02 Similar to NAC-domain containing protein 21/22 (ANAC021) (ANAC022). Splice isoform 2.
MGLRDIELTLPPGFRFYPSDEELVCHYLHNKVVNQHRFAGVGGAAAAGGGTMVEVDLHTH
EPWELPDVAKLSTNEWYFFSFRDRKYATGLRTNRATKSGYWKATGKDRVIHNPKLHAAAH
RRASIVGMRKTLVFYRGRAPNGVKTNWVMHEFRMENPHTPPKEDWVLCRVFYKKKAETET
ESSYSMENEQEAVIAMARSAAAIKAGGCYSNSSSSHDPAAAGHHSPPPFPASLAACSSSH
HYSSHPPPPPDHHHHHHMPVTGGGGGSLNEFIPTTSMALYSSIFDFSQHLDGGAVAASAS
AAGSRVDGGEQCGLMELGLEEHYNYNGLMPM*

5'UTR

chr02:34673486..34673591 (+ strand) : 106 bp

CDS

chr02:34673592..34673790 (+ strand) : 199 bp

chr02:34674843..34675129 (+ strand) : 287 bp

chr02:34675502..34676011 (+ strand) : 510 bp

3'UTR

chr02:34676012..34676309 (+ strand) : 298 bp

FASTA

>Os02t0810900-02 class=Sequence position=chr02:34673486..34676309 (+ strand)
CTAGCTACCA CTTCCAAAAT ACTCCACAGA GATCAATCAC ATATAGATAT AGCTAGATTG CTATAGACAG AGAGATCATC
AAAGAAATTT AGCAGGTGAT AGCCACATGG GGTTGAGGGA CATCGAGCTG ACGCtgcctc cggggttccg gttctacccg
agcgacgagg agcttgtctg ccactacctt cataacaagg tggtgaacca gcatcgcttc gccggagttg gaggagccgc
cgccgccggc ggcggcacca tggtcgaggt ggacctccac acccacgagc cgtgggagct accaggtaat caCTTACTCA
ATCAAAATTA ATTAATTAAT TACTACTCCT TTTTCCTCTC CCACAAGCGA CCCTCTCACt agctccaaat catttatagc
taatgtaata gtcaattcat acaatagttg cttactgtac tattaatacc tggtcctacc tgtcatacac atattacgtc
ttagagtccg tgctacagct gactatatac ctatagtctc ctgctcttct ctctcttcct ttatcttttt aaaatatgtt
tatagctggc ttatagcttg ctattgtacc tgctcTTAGC CACGCGCCCT CTCTCTCCCC TCTTCTGCAT GATTATGGTT
AATTAAATCG TAGATGGTTC CTCCGTTTCC ATGGAATGAT TAATTACGCA CGCAACCACG CTTTATTGGC TCCAATTAGG
ATTGTCGTTA TTCTTCCCCC TTGTTAATTA ACCAACAAGG CACGGGTCGA TCCATCACGT ATATCTCTGT GCGCGTATGT
GCaacagtgt gttatatatt gcttctggtg caagcataca tatacctata tctataattt atttctttat gactgcaAGT
GGGCTATCTA AGCTCTAGCT ATAGCTTGTT CTCTTTGTCT CTTACGATTA CGATCAAATT TCCCATCAAT TTTTATACAT
GTTTAAAATT TAACTTATTT CATTCCATAT CAACATTTTC TTCAGGACAT ACTACTATAT GTGTGCATAA ACTCTCCTTA
ATTTCCCCGC GCGCCGGCCC ATCCTATTCT CAAAAAAAAA AAAACTGAGA ACAATAAAAA TATACATAAT ATTGAAAAAG
ATTAAATTAA CCGGTTTGTT TAATTTCCCT CAATCAAATC GATCTGCTTT CCAAAATTTC TGAATAATTA ACGGTATTTC
TTTACAAAAC TGCAGGAACA AGTTTAATCA GAATCATATC GAACAATTAA TCAAGTAGCT AGTATTATAC CACATACTGA
ATATATTACG GTTGATCTCA GATTAGTCTA GATTAATCGA GTTGTGATGT GAAAAATTAa ttatggtgtg catgcagatg
tggcgaagct gagcacgaac gagtggtact tcttcagctt ccgcgaccgc aagtacgcga cggggctccg cacgaaccgc
gccaccaagt ccggctactg gaaggccacc ggcaaggacc gcgtcatcca caaccccaag ctgcacgccg ccgcccaccg
ccgcgcctcc atcgtcggca tgcgcaagac ccttgtcttc taccgcggcc gcgcccccaa cggcgtcaaa accaactggg
tcatgcacga atttcgcatg gaaaaccctc acaccccTCC CAAGGTTAGT CCTCACAATC CAACTAATTT CTCCAATAAT
TTCCTTACTC CTTTCATCCT CAAATAAATA AAATCCAGCA CGGGTTATGG TAAGACCTGT TTagtcaaac tgttttaagt
ttaaccaagt ttgtagaaaa aataataata tttttaaccc atgacaaatt tattaagaaa attaattcaa ttattgattt
gataaactaa tttagtatca taaatattac tatatttatc tataaaatta gttaaacttg aaatagtttg actttATTAG
AGTTAAAACG TGTTATAACC TGAAGGAGTA TAGTAGTAAC TTTTGGTTAA TCAAGAGCTT GAGTTTGTGT GTTTAATTTT
GCATATGTGT ATGCAGGAGG ATTGGGTGTT GTGCAGAGTG TTCTACAAGA AGAAGGCGGA GACGGAGACG GAGTCGTCGT
ACAGCATGGA GAACGAGCAG GAGGCGGTGA TCGCCATGGC ACGGAGCGCC GCGGCCATCA AGGCGGGTGG ATGCTACTCC
AACTCCTCCT CGTCTCACGA CCCAGCCGCC GCCGGCCATC ACTCGCCCCC GCCATTCCCG GCGTCGCTCG CCGCCTGCAG
CAGCAGCCAC CACTACAGCA GCCACCCACC GCCGCCTCCC GATCACCACC ACCACCACCA CATGCCCGTC ACCGGCGGCG
GCGGCGGCTC CCTCAACGAG TTCATCCCCA CCACCAGCAT GGCGCTGTAC AGCAGCATCT TCGACTTCAG CCAGCATCTC
GACGGCGGCG CCGTGGCGGC GTCGGCGTCG GCGGCGGGAT CGAGGGTCGA CGGCGGCGAG CAGTGCGGTC TGATGGAGCT
AGGGCTCGAG GAGCACTACA ATTACAACGG CCTGATGCCG ATGTGACGAT CCACCATAGG TGTCGGTGCT GCTAGTGCTA
GCTTAGCTAG CTTACACACA CTCCCAGCTG CTAGCTAGCT GCAGTTCTGC AGCGCAGCTA GCTAGCGTTT ATTATTAATA
ACCTCTTTTC ACCTCGATTG TTTGATCTGA TTTGTTTCGT GGTGATCGAT TCCATCGATC AGCTTGTGCA GATTTCGTTG
ATTGTGCATG CAAACATGCG CACCTGTGTA TAGGGTATAG TGGTACGTCG TATAGCGCTG TTGCATTGTT TGGAGGTAAA
TTATATATCT TAGCCTTTAA TTTG

Locus: Os02g0810900

Loading...

Locus: Os02g0810900

Loading...