Os02t0817600-01

Locus

Os02g0817600

Description

AUX/IAA protein family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA10

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA10, OsIAA5, DLN71, OsDLN71

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 10, DLN repressor 71, DLN motif protein 71, Indoleacetic Acid-Induced 10

Transcript Evidence

AK069892 (DDBJ, Best hit)

Protein Evidence

Q0DWF2-2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

J023039N11 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0817600-01)

RiceXPro (AK069892)

Others

Oryzabase (10901)

KEGG (Os02t0817600-01)

Transcript

1297 bp

>Os02t0817600-01 AUX/IAA protein family protein.
AGCTTAATTATAGCCTTCCTCCTCCTCCTTTCCTCCCTCTCGAGGCCCAGGTGTTCGTCC
GTGTCCTCTTCTCCACTCCACACACGCACACGCACAAGCCAAGCAGCAAGCAGCGGCGCC
GATGAGAGGAGGAGTAGCTGGGCCCACCGCCGGCGAGCCGCCGGGGACGGAGGCGGAGGC
GGAGGAGGTGGAGGAGAGCTCAGCTGGGGACGACGAGGAGCTGGAGCTCGGGCTCAGCCT
TGGCTCCAAGAAACAGCAGCAGCAGCAGCATGCGCCGTGCCGAATCCTGACGGCCAGGGA
CCTGCAGCCGGCGGCGGCGCTGTCACCGGACTCCTCCGTGTCGTCGTCATCCCCCGCGGC
GGCGGCGGCGGCGGGGGGGAAGAGGGCTGAGGGCCCCACCGCCACCACCTCGCCTGGGAC
GGTTGCTTCCGGCCATCCACACAGCTTTGGAGTGGTGGGATGGCCACCGATCCGACAGTT
CAGGATGAACAGCCTGTTCAATCAGGCTAAAGAAAACACATCTGAAACCGACACCAAGAA
GACCGCCACCAATGAATCTGATGTGCAGAAGGACAAGGAGGAGGGCGAAAAGAAAGGACG
GGTTGCTGGATGGGTGAAGGTGAACATGGATGGAGAGGTCATTGGAAGGAAGGTGGATCT
CAATGCGCACCGCTCATACAAGACCCTTGCATTAGCCCTTGAACTCATGTTCACGAAGCC
GTCCATTGGCCTTTGCGCTTCTCATAATACAAACTCGCTGAAACTACTAGACAACTCTGC
CGAATACCAGCTCACCTACGAGGACAGGGATGGTGACTGGATGCTCGTTGGAGATGTTCC
TTGGGAAATGTTTGTCAGCTCTGTGAAGAGGTTGAGGATCATGAGGACATCAGATGCGAA
TGGTCTTGGTCAGCGATACCAGGGAATTCACAGAACCATTGCTTCAACAAGAGGCAGATC
CTGAGAGCGTGTGACAAGGAAAAGAGCTATACCGCTGGTGAAGCTTGGAGCGTGCTTGAT
GGTTAATTACTTGTCCAGTTAAAATAGCAGAAGGCTAGTAAGAAAGAGCCACAGGGCTCA
CCCGGTTCTGTTATATTTTTGCCTTTGTGGTGCCTGTTTTTGTTTGCACTGTCGATCTGC
AAGAGCATATGGTCGCCTTGCTCTGCTTGCATGTACAAGTATGTCTTTCTAGTAGTTTTT
ATGGTGTTTGATGATGATCCTTGTGCCTACCTGATTACTACTGACTCTTGCACAGCCTCA
CAAATCTCTATGAATTAGCCCTGGAGTTTCATTGATT

CDS

843 bp

>Os02t0817600-01 AUX/IAA protein family protein.
ATGAGAGGAGGAGTAGCTGGGCCCACCGCCGGCGAGCCGCCGGGGACGGAGGCGGAGGCG
GAGGAGGTGGAGGAGAGCTCAGCTGGGGACGACGAGGAGCTGGAGCTCGGGCTCAGCCTT
GGCTCCAAGAAACAGCAGCAGCAGCAGCATGCGCCGTGCCGAATCCTGACGGCCAGGGAC
CTGCAGCCGGCGGCGGCGCTGTCACCGGACTCCTCCGTGTCGTCGTCATCCCCCGCGGCG
GCGGCGGCGGCGGGGGGGAAGAGGGCTGAGGGCCCCACCGCCACCACCTCGCCTGGGACG
GTTGCTTCCGGCCATCCACACAGCTTTGGAGTGGTGGGATGGCCACCGATCCGACAGTTC
AGGATGAACAGCCTGTTCAATCAGGCTAAAGAAAACACATCTGAAACCGACACCAAGAAG
ACCGCCACCAATGAATCTGATGTGCAGAAGGACAAGGAGGAGGGCGAAAAGAAAGGACGG
GTTGCTGGATGGGTGAAGGTGAACATGGATGGAGAGGTCATTGGAAGGAAGGTGGATCTC
AATGCGCACCGCTCATACAAGACCCTTGCATTAGCCCTTGAACTCATGTTCACGAAGCCG
TCCATTGGCCTTTGCGCTTCTCATAATACAAACTCGCTGAAACTACTAGACAACTCTGCC
GAATACCAGCTCACCTACGAGGACAGGGATGGTGACTGGATGCTCGTTGGAGATGTTCCT
TGGGAAATGTTTGTCAGCTCTGTGAAGAGGTTGAGGATCATGAGGACATCAGATGCGAAT
GGTCTTGGTCAGCGATACCAGGGAATTCACAGAACCATTGCTTCAACAAGAGGCAGATCC
TGA

Protein

281 aa

>Os02t0817600-01 AUX/IAA protein family protein.
MRGGVAGPTAGEPPGTEAEAEEVEESSAGDDEELELGLSLGSKKQQQQQHAPCRILTARD
LQPAAALSPDSSVSSSSPAAAAAAGGKRAEGPTATTSPGTVASGHPHSFGVVGWPPIRQF
RMNSLFNQAKENTSETDTKKTATNESDVQKDKEEGEKKGRVAGWVKVNMDGEVIGRKVDL
NAHRSYKTLALALELMFTKPSIGLCASHNTNSLKLLDNSAEYQLTYEDRDGDWMLVGDVP
WEMFVSSVKRLRIMRTSDANGLGQRYQGIHRTIASTRGRS*

5'UTR

chr02:35075679..35075799 (- strand) : 121 bp

CDS

chr02:35075356..35075678 (- strand) : 323 bp

chr02:35074521..35074819 (- strand) : 299 bp

chr02:35074169..35074271 (- strand) : 103 bp

chr02:35073977..35074038 (- strand) : 62 bp

chr02:35073704..35073759 (- strand) : 56 bp

3'UTR

chr02:35073371..35073703 (- strand) : 333 bp

FASTA

>Os02t0817600-01 class=Sequence position=chr02:35073371..35075799 (- strand)
AGCTTAATTA TAGCCTTCCT CCTCCTCCTT TCCTCCCTCT CGAGGCCCAG GTGTTCGTCC GTGTCCTCTT CTCCACTCCA
CACACGCACA CGCACAAGCC AAGCAGCAAG CAGCGGCGCC GATGAGAGGA GGAGTAGCTG GGCCCACCGC CGGCGAGCCG
CCGGGGACGG AGGCGGAGGC GGAGGAGGTG GAGGAGAGCT CAGCTGGGGA CGACGAGGAG CTGGAGCTCG GGCTCAGCCT
TGGCTCCAAG AAACAGCAGC AGCAGCAGCA TGCGCCGTGC CGAATCCTGA CGGCCAGGGA CCTGCAGCCG GCGGCGGCGC
TGTCACCGGA CTCCTCCGTG TCGTCGTCAT CCCCCGCGGC GGCGGCGGCG GCGGGGGGGA AGAGGGCTGA GGGCCCCACC
GCCACCACCT CGCCTGGGAC GGTTGCTTCC GGCCATCCAC ACAGGTGAGC TGAGCAGAGC AGAGCAGAAC ACAACACCTT
CAGGGTTCTT GCTTCTTCTC TGCCTCATAA TTTCATATAT AGCACTATAT TTATTACTCG ATACAAAAAC AGTTTCTTTT
ATGATTCTCT GAAGTAGTAA GAGTAGCAGT AATAAATTTG TCTGCAAGAT TGGTTGCCAC TTGTTCTGCT CACTGGTTAG
CATCATAGGA TATTTGCATA TGGCTTCTCC TGTAGTTGTG CATAGAACTC ACATCAGCAA CAACCTCCAA AACCTATTAT
TATCTACACT CCACACCTGT GCTGTGCATA AGCTTCTTAT CCTTCCAAAT TCAAGGACAA AAAATGACAA GTTTGGTGCT
TGATCTGCAC TCTAATATGT AACTACAAAC ACTTTTGTTT GACTTGTGGC GCTAGTAAGA TTTTCTCTGA AATGAGGACC
AGATATATAT CAGCACCAGA GTTGCTGAGC TACACCTACA CATGTAGACT TTTCAATACA TTTCAACTAA TCCCAACTGC
ATTTCCTGGT TTGGCAGCAG CTTTGGAGTG GTGGGATGGC CACCGATCCG ACAGTTCAGG ATGAACAGCC TGTTCAATCA
GGCTAAAGAA AACACATCTG AAACCGACAC CAAGAAGACC GCCACCAATG AATCTGATGT GCAGAAGGAC AAGGAGGAGG
GCGAAAAGAA AGGACGGGTT GCTGGATGGG TGAAGGTGAA CATGGATGGA GAGGTCATTG GAAGGAAGGT GGATCTCAAT
GCGCACCGCT CATACAAGAC CCTTGCATTA GCCCTTGAAC TCATGTTCAC GAAGCCGTCC ATTGGCCTTT GCGCTTCTCG
TAAGCTCGAG TCTGAACTGT CACTTTAAGT AGCTCACAGT TTCACATATT TTCAAATCAC ATCAAGTTAA GTGGAATCAA
GCTTTGCTGC GCACAATACA TAATAATAGT GTAGGACAAT GAGATAGTTT TGCAAATTAA AATAATAGCC ATGCTTCATA
TTGTACCTAG TAAGTCGCAA GCTTTTTTCA TGATAGGTTG ATTCATCTTG TCCATGAACC TGAATTATGG TTATCTTCGC
ATTTTCAGAT AATACAAACT CGCTGAAACT ACTAGACAAC TCTGCCGAAT ACCAGCTCAC CTACGAGGAC AGGGATGGTG
ACTGGATGCT CGTTGGAGAT GTTCCTTGGG AGTAAGTCGT TGCACTATGT AGCTATTAGA ACCTGGGCAC TAGAAATTTT
TATAGTTCTA ATTTTCAAGG CGACTTCGAA TAGCTATTCA GGTGACTTAT TATTACGGTG TTGCCTTGTT CTTGTGCGCA
GAATGTTTGT CAGCTCTGTG AAGAGGTTGA GGATCATGAG GACATCAGAT GCGAATGGTC TTGGTTAGAT TCTTTTCTAC
CACCTATTAC ATTTGATGCT AGTCAGTCGT CTGAATGGAA TCGATTATTG TTGTATGTAT AACCTGTTGA ACTGAATCTA
GAGGATAACT TGAAATAGCT TGTTTTGCCA CTAGTAGGAT TTTAGCACTT TAATCAGCTA AAACGCACCC GTTTAGGTTC
TAACCTGATT TGCGCTCATT TTACCGACAA TCCGTTGCAG GTCAGCGATA CCAGGGAATT CACAGAACCA TTGCTTCAAC
AAGAGGCAGA TCCTGAGAGC GTGTGACAAG GAAAAGAGCT ATACCGCTGG TGAAGCTTGG AGCGTGCTTG ATGGTTAATT
ACTTGTCCAG TTAAAATAGC AGAAGGCTAG TAAGAAAGAG CCACAGGGCT CACCCGGTTC TGTTATATTT TTGCCTTTGT
GGTGCCTGTT TTTGTTTGCA CTGTCGATCT GCAAGAGCAT ATGGTCGCCT TGCTCTGCTT GCATGTACAA GTATGTCTTT
CTAGTAGTTT TTATGGTGTT TGATGATGAT CCTTGTGCCT ACCTGATTAC TACTGACTCT TGCACAGCCT CACAAATCTC
TATGAATTAG CCCTGGAGTT TCATTGATT

Locus: Os02g0817600

Loading...

Locus: Os02g0817600

Loading...