Os02t0817600-02

Locus

Os02g0817600

Description

Similar to Auxin-responsive protein IAA10.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA10

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA10, OsIAA5, DLN71, OsDLN71

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 10, DLN repressor 71, DLN motif protein 71, Indoleacetic Acid-Induced 10

Transcript Evidence

AK104501 (DDBJ, Best hit)

Protein Evidence

Q0DWF2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

006-302-E07 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0817600-02)

RiceXPro (AK104501)

Others

Oryzabase (10901)

KEGG (Os02t0817600-02)

Transcript

1180 bp

>Os02t0817600-02 Similar to Auxin-responsive protein IAA10.
CTCTCGAGGCCCAGGTGTTCGTCCGTGTCCTCTTCTCCACTCCACACACGCACACGCACA
AGCCAAGCAGCAAGCAGCGGCGCCGATGAGAGGAGGAGTAGCTGGGCCCACCGCCGGCGA
GCCGCCGGGGACGGAGGCGGAGGCGGAGGAGGTGGAGGAGAGCTCAGCTGGGGACGACGA
GGAGCTGGAGCTCGGGCTCAGCCTTGGCTCCAAGAAACAGCAGCAGCAGCAGCATGCGCC
GTGCCGAATCCTGACGGCCAGGGACCTGCAGCCGGCGGCGGCGCTGTCACCGGACTCCTC
CGTGTCGTCGTCATCCCCCGCGGCGGCGGCGGCGGCGGGGGGGAAGAGGGCTGAGGGCCC
CACCGCCACCACCTCGCCTGGGACGGTTGCTTCCGGCCATCCACACAGCAGCTTTGGAGT
GGTGGGATGGCCACCGATCCGACAGTTCAGGATGAACAGCCTGTTCAATCAGGCTAAAGA
AAACACATCTGAAACCGACACCAAGAAGACCGCCACCAATGAATCTGATGTGCAGAAGGA
CAAGGAGGAGGGCGAAAAGAAAGGACGGGTTGCTGGATGGGTGAAGGTGAACATGGATGG
AGAGGTCATTGGAAGGAAGGTGGATCTCAATGCGCACCGCTCATACAAGACCCTTGCATT
AGCCCTTGAACTCATGTTCACGAAGCCGTCCATTGGCCTTTGCGCTTCTCATAATACAAA
CTCGCTGAAACTACTAGACAACTCTGCCGAATACCAGCTCACCTACGAGGACAGGGATGG
TGACTGGATGCTCGTTGGAGATGTTCCTTGGGAAATGTTTGTCAGCTCTGTGAAGAGGTT
GAGGATCATGAGGACATCAGATGCGAATGGTCTTGGTCAGCGATACCAGGGAATTCACAG
AACCATTGCTTCAACAAGAGGCAGATCCTGAGAGCGTGTGACAAGGAAAAGAGCTATACC
GCTGGTGAAGCTTGGAGCGTGCTTGATGGTTAATTACTTGTCCAGTTAAAATAGCAGAAG
GCTAGTAAGAAAGAGCCACAGGGCTCACCCGGTTCTGTTATATTTTTGCCTTTGTGGTGC
CTGTTTTTGTTTGCACTGTCGATCTGCAAGAGCATATGGTCGCCTTGCTCTGCTTGCATG
TACAAGTATGTCTTTCTAGTAGTTTTTATGGTGTTTGATG

CDS

846 bp

>Os02t0817600-02 Similar to Auxin-responsive protein IAA10.
ATGAGAGGAGGAGTAGCTGGGCCCACCGCCGGCGAGCCGCCGGGGACGGAGGCGGAGGCG
GAGGAGGTGGAGGAGAGCTCAGCTGGGGACGACGAGGAGCTGGAGCTCGGGCTCAGCCTT
GGCTCCAAGAAACAGCAGCAGCAGCAGCATGCGCCGTGCCGAATCCTGACGGCCAGGGAC
CTGCAGCCGGCGGCGGCGCTGTCACCGGACTCCTCCGTGTCGTCGTCATCCCCCGCGGCG
GCGGCGGCGGCGGGGGGGAAGAGGGCTGAGGGCCCCACCGCCACCACCTCGCCTGGGACG
GTTGCTTCCGGCCATCCACACAGCAGCTTTGGAGTGGTGGGATGGCCACCGATCCGACAG
TTCAGGATGAACAGCCTGTTCAATCAGGCTAAAGAAAACACATCTGAAACCGACACCAAG
AAGACCGCCACCAATGAATCTGATGTGCAGAAGGACAAGGAGGAGGGCGAAAAGAAAGGA
CGGGTTGCTGGATGGGTGAAGGTGAACATGGATGGAGAGGTCATTGGAAGGAAGGTGGAT
CTCAATGCGCACCGCTCATACAAGACCCTTGCATTAGCCCTTGAACTCATGTTCACGAAG
CCGTCCATTGGCCTTTGCGCTTCTCATAATACAAACTCGCTGAAACTACTAGACAACTCT
GCCGAATACCAGCTCACCTACGAGGACAGGGATGGTGACTGGATGCTCGTTGGAGATGTT
CCTTGGGAAATGTTTGTCAGCTCTGTGAAGAGGTTGAGGATCATGAGGACATCAGATGCG
AATGGTCTTGGTCAGCGATACCAGGGAATTCACAGAACCATTGCTTCAACAAGAGGCAGA
TCCTGA

Protein

282 aa

>Os02t0817600-02 Similar to Auxin-responsive protein IAA10.
MRGGVAGPTAGEPPGTEAEAEEVEESSAGDDEELELGLSLGSKKQQQQQHAPCRILTARD
LQPAAALSPDSSVSSSSPAAAAAAGGKRAEGPTATTSPGTVASGHPHSSFGVVGWPPIRQ
FRMNSLFNQAKENTSETDTKKTATNESDVQKDKEEGEKKGRVAGWVKVNMDGEVIGRKVD
LNAHRSYKTLALALELMFTKPSIGLCASHNTNSLKLLDNSAEYQLTYEDRDGDWMLVGDV
PWEMFVSSVKRLRIMRTSDANGLGQRYQGIHRTIASTRGRS*

5'UTR

chr02:35075679..35075763 (- strand) : 85 bp

CDS

chr02:35075356..35075678 (- strand) : 323 bp

chr02:35074521..35074822 (- strand) : 302 bp

chr02:35074169..35074271 (- strand) : 103 bp

chr02:35073977..35074038 (- strand) : 62 bp

chr02:35073704..35073759 (- strand) : 56 bp

3'UTR

chr02:35073455..35073703 (- strand) : 249 bp

FASTA

>Os02t0817600-02 class=Sequence position=chr02:35073455..35075763 (- strand)
CTCTCGAGGC CCAGGTGTTC GTCCGTGTCC TCTTCTCCAC TCCACACACG CACACGCACA AGCCAAGCAG CAAGCAGCGG
CGCCGATGAG AGGAGGAGTA GCTGGGCCCA CCGCCGGCGA GCCGCCGGGG ACGGAGGCGG AGGCGGAGGA GGTGGAGGAG
AGCTCAGCTG GGGACGACGA GGAGCTGGAG CTCGGGCTCA GCCTTGGCTC CAAGAAACAG CAGCAGCAGC AGCATGCGCC
GTGCCGAATC CTGACGGCCA GGGACCTGCA GCCGGCGGCG GCGCTGTCAC CGGACTCCTC CGTGTCGTCG TCATCCCCCG
CGGCGGCGGC GGCGGCGGGG GGGAAGAGGG CTGAGGGCCC CACCGCCACC ACCTCGCCTG GGACGGTTGC TTCCGGCCAT
CCACACAGGT GAGCTGAGCA GAGCAGAGCA GAACACAACA CCTTCAGGGT TCTTGCTTCT TCTCTGCCTC ATAATTTCAT
ATATAGCACT ATATTTATTA CTCGATACAA AAACAGTTTC TTTTATGATT CTCTGAAGTA GTAAGAGTAG CAGTAATAAA
TTTGTCTGCA AGATTGGTTG CCACTTGTTC TGCTCACTGG TTAGCATCAT AGGATATTTG CATATGGCTT CTCCTGTAGT
TGTGCATAGA ACTCACATCA GCAACAACCT CCAAAACCTA TTATTATCTA CACTCCACAC CTGTGCTGTG CATAAGCTTC
TTATCCTTCC AAATTCAAGG ACAAAAAATG ACAAGTTTGG TGCTTGATCT GCACTCTAAT ATGTAACTAC AAACACTTTT
GTTTGACTTG TGGCGCTAGT AAGATTTTCT CTGAAATGAG GACCAGATAT ATATCAGCAC CAGAGTTGCT GAGCTACACC
TACACATGTA GACTTTTCAA TACATTTCAA CTAATCCCAA CTGCATTTCC TGGTTTGGCA GCAGCTTTGG AGTGGTGGGA
TGGCCACCGA TCCGACAGTT CAGGATGAAC AGCCTGTTCA ATCAGGCTAA AGAAAACACA TCTGAAACCG ACACCAAGAA
GACCGCCACC AATGAATCTG ATGTGCAGAA GGACAAGGAG GAGGGCGAAA AGAAAGGACG GGTTGCTGGA TGGGTGAAGG
TGAACATGGA TGGAGAGGTC ATTGGAAGGA AGGTGGATCT CAATGCGCAC CGCTCATACA AGACCCTTGC ATTAGCCCTT
GAACTCATGT TCACGAAGCC GTCCATTGGC CTTTGCGCTT CTCGTAAGCT CGAGTCTGAA CTGTCACTTT AAGTAGCTCA
CAGTTTCACA TATTTTCAAA TCACATCAAG TTAAGTGGAA TCAAGCTTTG CTGCGCACAA TACATAATAA TAGTGTAGGA
CAATGAGATA GTTTTGCAAA TTAAAATAAT AGCCATGCTT CATATTGTAC CTAGTAAGTC GCAAGCTTTT TTCATGATAG
GTTGATTCAT CTTGTCCATG AACCTGAATT ATGGTTATCT TCGCATTTTC AGATAATACA AACTCGCTGA AACTACTAGA
CAACTCTGCC GAATACCAGC TCACCTACGA GGACAGGGAT GGTGACTGGA TGCTCGTTGG AGATGTTCCT TGGGAGTAAG
TCGTTGCACT ATGTAGCTAT TAGAACCTGG GCACTAGAAA TTTTTATAGT TCTAATTTTC AAGGCGACTT CGAATAGCTA
TTCAGGTGAC TTATTATTAC GGTGTTGCCT TGTTCTTGTG CGCAGAATGT TTGTCAGCTC TGTGAAGAGG TTGAGGATCA
TGAGGACATC AGATGCGAAT GGTCTTGGTT AGATTCTTTT CTACCACCTA TTACATTTGA TGCTAGTCAG TCGTCTGAAT
GGAATCGATT ATTGTTGTAT GTATAACCTG TTGAACTGAA TCTAGAGGAT AACTTGAAAT AGCTTGTTTT GCCACTAGTA
GGATTTTAGC ACTTTAATCA GCTAAAACGC ACCCGTTTAG GTTCTAACCT GATTTGCGCT CATTTTACCG ACAATCCGTT
GCAGGTCAGC GATACCAGGG AATTCACAGA ACCATTGCTT CAACAAGAGG CAGATCCTGA GAGCGTGTGA CAAGGAAAAG
AGCTATACCG CTGGTGAAGC TTGGAGCGTG CTTGATGGTT AATTACTTGT CCAGTTAAAA TAGCAGAAGG CTAGTAAGAA
AGAGCCACAG GGCTCACCCG GTTCTGTTAT ATTTTTGCCT TTGTGGTGCC TGTTTTTGTT TGCACTGTCG ATCTGCAAGA
GCATATGGTC GCCTTGCTCT GCTTGCATGT ACAAGTATGT CTTTCTAGTA GTTTTTATGG TGTTTGATG

Locus: Os02g0817600

Loading...

Locus: Os02g0817600

Loading...