Os02t0817600-03

Locus

Os02g0817600

Description

AUX/IAA protein family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA10

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA10, OsIAA5, DLN71, OsDLN71

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 10, DLN repressor 71, DLN motif protein 71, Indoleacetic Acid-Induced 10

Transcript Evidence

AK104802 (DDBJ, Best hit)

Protein Evidence

Q0DWF2-2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

001-040-C05 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0817600-03)

RiceXPro (AK104802)

Others

Oryzabase (10901)

KEGG (Os02t0817600-03)

Transcript

1175 bp

>Os02t0817600-03 AUX/IAA protein family protein.
CTCGAGGCCCAGGTGTTCGTCCGTGTCCTCTTCTCCACTCCACACACGCACACGCACAAG
CCAAGCAGCAAGCAGCGGCGCCGATGAGAGGAGGAGTAGCTGGGCCCACCGCCGGCGAGC
CGCCGGGGACGGAGGCGGAGGCGGAGGAGGTGGAGGAGAGCTCAGCTGGGGACGACGAGG
AGCTGGAGCTCGGGCTCAGCCTTGGCTCCAAGAAACAGCAGCAGCAGCAGCATGCGCCGT
GCCGAATCCTGACGGCCAGGGACCTGCAGCCGGCGGCGGCGCTGTCACCGGACTCCTCCG
TGTCGTCGTCATCCCCCGCGGCGGCGGCGGCGGCGGGGGGGAAGAGGGCTGAGGGCCCCA
CCGCCACCACCTCGCCTGGGACGGTTGCTTCCGGCCATCCACACAGCTTTGGAGTGGTGG
GATGGCCACCGATCCGACAGTTCAGGATGAACAGCCTGTTCAATCAGGCTAAAGAAAACA
CATCTGAAACCGACACCAAGAAGACCGCCACCAATGAATCTGATGTGCAGAAGGACAAGG
AGGAGGGCGAAAAGAAAGGACGGGTTGCTGGATGGGTGAAGGTGAACATGGATGGAGAGG
TCATTGGAAGGAAGGTGGATCTCAATGCGCACCGCTCATACAAGACCCTTGCATTAGCCC
TTGAACTCATGTTCACGAAGCCGTCCATTGGCCTTTGCGCTTCTCATAATACAAACTCGC
TGAAACTACTAGACAACTCTGCCGAATACCAGCTCACCTACGAGGACAGGGATGGTGACT
GGATGCTCGTTGGAGATGTTCCTTGGGAAATGTTTGTCAGCTCTGTGAAGAGGTTGAGGA
TCATGAGGACATCAGATGCGAATGGTCTTGGTCAGCGATACCAGGGAATTCACAGAACCA
TTGCTTCAACAAGAGGCAGATCCTGAGAGCGTGTGACAAGGAAAAGAGCTATACCGCTGG
TGAAGCTTGGAGCGTGCTTGATGGTTAATTACTTGTCCAGTTAAAATAGCAGAAGGCTAG
TAAGAAAGAGCCACAGGGCTCACCCGGTTCTGTTATATTTTTGCCTTTGTGGTGCCTGTT
TTTGTTTGCACTGTCGATCTGCAAGAGCATATGGTCGCCTTGCTCTGCTTGCATGTACAA
GTATGTCTTTCTAGTAGTTTTTATGGTGTTTGATG

CDS

843 bp

>Os02t0817600-03 AUX/IAA protein family protein.
ATGAGAGGAGGAGTAGCTGGGCCCACCGCCGGCGAGCCGCCGGGGACGGAGGCGGAGGCG
GAGGAGGTGGAGGAGAGCTCAGCTGGGGACGACGAGGAGCTGGAGCTCGGGCTCAGCCTT
GGCTCCAAGAAACAGCAGCAGCAGCAGCATGCGCCGTGCCGAATCCTGACGGCCAGGGAC
CTGCAGCCGGCGGCGGCGCTGTCACCGGACTCCTCCGTGTCGTCGTCATCCCCCGCGGCG
GCGGCGGCGGCGGGGGGGAAGAGGGCTGAGGGCCCCACCGCCACCACCTCGCCTGGGACG
GTTGCTTCCGGCCATCCACACAGCTTTGGAGTGGTGGGATGGCCACCGATCCGACAGTTC
AGGATGAACAGCCTGTTCAATCAGGCTAAAGAAAACACATCTGAAACCGACACCAAGAAG
ACCGCCACCAATGAATCTGATGTGCAGAAGGACAAGGAGGAGGGCGAAAAGAAAGGACGG
GTTGCTGGATGGGTGAAGGTGAACATGGATGGAGAGGTCATTGGAAGGAAGGTGGATCTC
AATGCGCACCGCTCATACAAGACCCTTGCATTAGCCCTTGAACTCATGTTCACGAAGCCG
TCCATTGGCCTTTGCGCTTCTCATAATACAAACTCGCTGAAACTACTAGACAACTCTGCC
GAATACCAGCTCACCTACGAGGACAGGGATGGTGACTGGATGCTCGTTGGAGATGTTCCT
TGGGAAATGTTTGTCAGCTCTGTGAAGAGGTTGAGGATCATGAGGACATCAGATGCGAAT
GGTCTTGGTCAGCGATACCAGGGAATTCACAGAACCATTGCTTCAACAAGAGGCAGATCC
TGA

Protein

281 aa

>Os02t0817600-03 AUX/IAA protein family protein.
MRGGVAGPTAGEPPGTEAEAEEVEESSAGDDEELELGLSLGSKKQQQQQHAPCRILTARD
LQPAAALSPDSSVSSSSPAAAAAAGGKRAEGPTATTSPGTVASGHPHSFGVVGWPPIRQF
RMNSLFNQAKENTSETDTKKTATNESDVQKDKEEGEKKGRVAGWVKVNMDGEVIGRKVDL
NAHRSYKTLALALELMFTKPSIGLCASHNTNSLKLLDNSAEYQLTYEDRDGDWMLVGDVP
WEMFVSSVKRLRIMRTSDANGLGQRYQGIHRTIASTRGRS*

5'UTR

chr02:35075679..35075761 (- strand) : 83 bp

CDS

chr02:35075356..35075678 (- strand) : 323 bp

chr02:35074521..35074819 (- strand) : 299 bp

chr02:35074169..35074271 (- strand) : 103 bp

chr02:35073977..35074038 (- strand) : 62 bp

chr02:35073704..35073759 (- strand) : 56 bp

3'UTR

chr02:35073455..35073703 (- strand) : 249 bp

FASTA

>Os02t0817600-03 class=Sequence position=chr02:35073455..35075761 (- strand)
CTCGAGGCCC AGGTGTTCGT CCGTGTCCTC TTCTCCACTC CACACACGCA CACGCACAAG CCAAGCAGCA AGCAGCGGCG
CCGATGAGAG GAGGAGTAGC TGGGCCCACC GCCGGCGAGC CGCCGGGGAC GGAGGCGGAG GCGGAGGAGG TGGAGGAGAG
CTCAGCTGGG GACGACGAGG AGCTGGAGCT CGGGCTCAGC CTTGGCTCCA AGAAACAGCA GCAGCAGCAG CATGCGCCGT
GCCGAATCCT GACGGCCAGG GACCTGCAGC CGGCGGCGGC GCTGTCACCG GACTCCTCCG TGTCGTCGTC ATCCCCCGCG
GCGGCGGCGG CGGCGGGGGG GAAGAGGGCT GAGGGCCCCA CCGCCACCAC CTCGCCTGGG ACGGTTGCTT CCGGCCATCC
ACACAGGTGA GCTGAGCAGA GCAGAGCAGA ACACAACACC TTCAGGGTTC TTGCTTCTTC TCTGCCTCAT AATTTCATAT
ATAGCACTAT ATTTATTACT CGATACAAAA ACAGTTTCTT TTATGATTCT CTGAAGTAGT AAGAGTAGCA GTAATAAATT
TGTCTGCAAG ATTGGTTGCC ACTTGTTCTG CTCACTGGTT AGCATCATAG GATATTTGCA TATGGCTTCT CCTGTAGTTG
TGCATAGAAC TCACATCAGC AACAACCTCC AAAACCTATT ATTATCTACA CTCCACACCT GTGCTGTGCA TAAGCTTCTT
ATCCTTCCAA ATTCAAGGAC AAAAAATGAC AAGTTTGGTG CTTGATCTGC ACTCTAATAT GTAACTACAA ACACTTTTGT
TTGACTTGTG GCGCTAGTAA GATTTTCTCT GAAATGAGGA CCAGATATAT ATCAGCACCA GAGTTGCTGA GCTACACCTA
CACATGTAGA CTTTTCAATA CATTTCAACT AATCCCAACT GCATTTCCTG GTTTGGCAGC AGCTTTGGAG TGGTGGGATG
GCCACCGATC CGACAGTTCA GGATGAACAG CCTGTTCAAT CAGGCTAAAG AAAACACATC TGAAACCGAC ACCAAGAAGA
CCGCCACCAA TGAATCTGAT GTGCAGAAGG ACAAGGAGGA GGGCGAAAAG AAAGGACGGG TTGCTGGATG GGTGAAGGTG
AACATGGATG GAGAGGTCAT TGGAAGGAAG GTGGATCTCA ATGCGCACCG CTCATACAAG ACCCTTGCAT TAGCCCTTGA
ACTCATGTTC ACGAAGCCGT CCATTGGCCT TTGCGCTTCT CGTAAGCTCG AGTCTGAACT GTCACTTTAA GTAGCTCACA
GTTTCACATA TTTTCAAATC ACATCAAGTT AAGTGGAATC AAGCTTTGCT GCGCACAATA CATAATAATA GTGTAGGACA
ATGAGATAGT TTTGCAAATT AAAATAATAG CCATGCTTCA TATTGTACCT AGTAAGTCGC AAGCTTTTTT CATGATAGGT
TGATTCATCT TGTCCATGAA CCTGAATTAT GGTTATCTTC GCATTTTCAG ATAATACAAA CTCGCTGAAA CTACTAGACA
ACTCTGCCGA ATACCAGCTC ACCTACGAGG ACAGGGATGG TGACTGGATG CTCGTTGGAG ATGTTCCTTG GGAGTAAGTC
GTTGCACTAT GTAGCTATTA GAACCTGGGC ACTAGAAATT TTTATAGTTC TAATTTTCAA GGCGACTTCG AATAGCTATT
CAGGTGACTT ATTATTACGG TGTTGCCTTG TTCTTGTGCG CAGAATGTTT GTCAGCTCTG TGAAGAGGTT GAGGATCATG
AGGACATCAG ATGCGAATGG TCTTGGTTAG ATTCTTTTCT ACCACCTATT ACATTTGATG CTAGTCAGTC GTCTGAATGG
AATCGATTAT TGTTGTATGT ATAACCTGTT GAACTGAATC TAGAGGATAA CTTGAAATAG CTTGTTTTGC CACTAGTAGG
ATTTTAGCAC TTTAATCAGC TAAAACGCAC CCGTTTAGGT TCTAACCTGA TTTGCGCTCA TTTTACCGAC AATCCGTTGC
AGGTCAGCGA TACCAGGGAA TTCACAGAAC CATTGCTTCA ACAAGAGGCA GATCCTGAGA GCGTGTGACA AGGAAAAGAG
CTATACCGCT GGTGAAGCTT GGAGCGTGCT TGATGGTTAA TTACTTGTCC AGTTAAAATA GCAGAAGGCT AGTAAGAAAG
AGCCACAGGG CTCACCCGGT TCTGTTATAT TTTTGCCTTT GTGGTGCCTG TTTTTGTTTG CACTGTCGAT CTGCAAGAGC
ATATGGTCGC CTTGCTCTGC TTGCATGTAC AAGTATGTCT TTCTAGTAGT TTTTATGGTG TTTGATG

Locus: Os02g0817600

Loading...

Locus: Os02g0817600

Loading...