Os02t0817700-02

Locus

Os02g0817700

Description

Similar to 3-ketoacyl-CoA thiolase (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsI57, I57, OsKAT1, KAT1

Oryzabase Gene Name Synonym(s)

3-ketoacyl-CoA thiolase, 3-ketoacyl-CoA thiolase-like protein

Transcript Evidence

AK069768 (DDBJ, Best hit)

AK061948 (DDBJ, Best hit)

Protein Evidence

B6TIL6 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J023030K20 (Online Clone Ordering)

001-042-E07 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0817700-02)

RiceXPro (AK069768)

Others

Oryzabase (13869)

KEGG (Os02t0817700-02 (EC:2.3.1.16))

Transcript

2044 bp

>Os02t0817700-02 Similar to 3-ketoacyl-CoA thiolase (Fragment).
AAGTAATCGGCGCTTTCGCGAGAGAGAGCGATACGAACAAGAGAAAATCTTCTCCAGACA
CCGCGGCGGGCTTCCCCACCCCATCGGAAGGAAGAAGACGACCAGCTCGCGCGCTCGGAT
CTCAGCCATGGAGAAGGCGATCGATCGCCAGCGCGTCCTCCTCGCCCACCTCCTCCCCTC
CTCCTCCTCCGACCAATCGCTCCTCTCCGCGTCGGCGTGCGCCGCCGGGGACAGCGCCGC
CTACCAGAGGACTTCCGCCTACGGGGACGACGTCGTCGTCGTCGCTGCCTACAGGACACC
CATATGCAAGGCCAAGCGAGGAGGTTTCAAGGATACATACCCAGAGGACCTTCTTACTGT
TGTTCTAAAGGCTGTTCTGGACAACACTAAGATCAACCCTGGTGAAATTGGTGACATTGT
AGTTGGCACGGTGCTAGGTCCAGGCTCGCAGCGTGCAATCGAGTGCAGGGCTGCGGCTTT
CTATGCTGGAGTTCCCGAAAACGTTCCTGTTAGAACTGTCAACCGGCAATGTTCCTCTGG
ATTACAGGCAGTGGCTGATGTTGCCGCGGCCATTAAAGCTGGGTTCTACGACATAGGGAT
TGGTGCAGGCCTGGAATCCATGTCAGTAAATGCTATGGGTTGGGAAGGACAAGTAAACCC
TAAAGTAAATGAAGTCCAGAAAGCACAGGATTGTCTTTTGCCCATGGGGATAACGTCCGA
AAATGTTGCGCACCGATATGGTGTAACAAGACAAGAGCAGGATCAGGCTGCTGCTGAGTC
TCATAGGAGGGCTGCTGCAGCCACAGCTGCTGGGAAATTCAAAGATGAGATTGTTCCGGT
GCCTACAAAGATTGTTGACCCCAAGACTGGAGAGGAAAAGAAAGTTGTGATATCAGTTGA
TGATGGAATTAGGCCAGGGACCACAGCATCTGGATTGGCAAAGCTTAAACCAGTTTTCCG
GAAGGATGGTACCACAACTGCAGGCAACTCTAGTCAAGTGAGCGATGGTGCTGGAGCTGT
TCTTCTCATGAGGAGGGACGTAGCGATGAAGAAGGGACTTCCTATTCTTGGTGTTTTCAG
GAGCTTTGCTGCTGTTGGAGTAGATCCTGCTGTTATGGGTGTTGGTCCTGCAGTAGCAAT
ACCAGCTGCAGTGAAGTCTGCTGGACTCCAGATTGAAGACATTGATCTGTTTGAATTGAA
TGAGGCCTTCGCTTCGCAGTTCGTGTATTGCTGCAACAAGCTGGGACTGGACAGGTCAAA
AGTAAACGTGAATGGAGGCGCAATCGCCCTAGGACATCCTCTTGGTGCAACAGGTGCCCG
GTGCGTCGCAACTCTTCTGAATGAAATGAAGCGCCGGGGCAGGGACTGCAGATTCGGTGT
TGTCACCATGTGCATTGGATCTGGCATGGGGGCAGCAGCTGTGTTTGAGCGGGGTGACTC
GGTCGACCAATTCTCAAACGTGCGCCACCATTAGCGGCAGTTTTCTAAGAGAAATGCAAA
GCAAAGCAGTGGTGCAAAATCATCATGGTGGTCAGTCCAATGGAGCATACTCTGGCAGTA
AGATCTATACCGAAAACTAAATGCAGGAAACACGTAATCTTCTCCGGTGAAAGGTGTAAC
AGTATATTGAAGATCTTTTCATGTAACATTTTGCACTAATAATAATTTATGCGAATAAGG
GGCATGCATGCTCAATGTTTGTTTTGTCAAGTGTTCCACACGAAACACTGAGAGGAGCAC
AGTGGTTGCAAATGTTGAAGGGCCTGATAAGGGTAGGCCTGATCATGGATAATTTGGCCC
AAATCAAATCTGGCCTGGCCTGATCGTTGTCCAAAATACTTAGTACTACTTTCTCTGTAA
AAAAATAATACAGTATAAAACAATTTATTTTGCTTGTTAGGACAATGCTTTAATCACCAA
CTGCTTTATTAATATATTATATTTATGTGACACAGAAGTATAATTACAGGAAAGCATTTG
TGAATATAAATCTAATAGCACTCATTACTTTTGAATGTAAATCTAATGACATTAATTTTG
TCTC

CDS

1347 bp

>Os02t0817700-02 Similar to 3-ketoacyl-CoA thiolase (Fragment).
ATGGAGAAGGCGATCGATCGCCAGCGCGTCCTCCTCGCCCACCTCCTCCCCTCCTCCTCC
TCCGACCAATCGCTCCTCTCCGCGTCGGCGTGCGCCGCCGGGGACAGCGCCGCCTACCAG
AGGACTTCCGCCTACGGGGACGACGTCGTCGTCGTCGCTGCCTACAGGACACCCATATGC
AAGGCCAAGCGAGGAGGTTTCAAGGATACATACCCAGAGGACCTTCTTACTGTTGTTCTA
AAGGCTGTTCTGGACAACACTAAGATCAACCCTGGTGAAATTGGTGACATTGTAGTTGGC
ACGGTGCTAGGTCCAGGCTCGCAGCGTGCAATCGAGTGCAGGGCTGCGGCTTTCTATGCT
GGAGTTCCCGAAAACGTTCCTGTTAGAACTGTCAACCGGCAATGTTCCTCTGGATTACAG
GCAGTGGCTGATGTTGCCGCGGCCATTAAAGCTGGGTTCTACGACATAGGGATTGGTGCA
GGCCTGGAATCCATGTCAGTAAATGCTATGGGTTGGGAAGGACAAGTAAACCCTAAAGTA
AATGAAGTCCAGAAAGCACAGGATTGTCTTTTGCCCATGGGGATAACGTCCGAAAATGTT
GCGCACCGATATGGTGTAACAAGACAAGAGCAGGATCAGGCTGCTGCTGAGTCTCATAGG
AGGGCTGCTGCAGCCACAGCTGCTGGGAAATTCAAAGATGAGATTGTTCCGGTGCCTACA
AAGATTGTTGACCCCAAGACTGGAGAGGAAAAGAAAGTTGTGATATCAGTTGATGATGGA
ATTAGGCCAGGGACCACAGCATCTGGATTGGCAAAGCTTAAACCAGTTTTCCGGAAGGAT
GGTACCACAACTGCAGGCAACTCTAGTCAAGTGAGCGATGGTGCTGGAGCTGTTCTTCTC
ATGAGGAGGGACGTAGCGATGAAGAAGGGACTTCCTATTCTTGGTGTTTTCAGGAGCTTT
GCTGCTGTTGGAGTAGATCCTGCTGTTATGGGTGTTGGTCCTGCAGTAGCAATACCAGCT
GCAGTGAAGTCTGCTGGACTCCAGATTGAAGACATTGATCTGTTTGAATTGAATGAGGCC
TTCGCTTCGCAGTTCGTGTATTGCTGCAACAAGCTGGGACTGGACAGGTCAAAAGTAAAC
GTGAATGGAGGCGCAATCGCCCTAGGACATCCTCTTGGTGCAACAGGTGCCCGGTGCGTC
GCAACTCTTCTGAATGAAATGAAGCGCCGGGGCAGGGACTGCAGATTCGGTGTTGTCACC
ATGTGCATTGGATCTGGCATGGGGGCAGCAGCTGTGTTTGAGCGGGGTGACTCGGTCGAC
CAATTCTCAAACGTGCGCCACCATTAG

Protein

449 aa

>Os02t0817700-02 Similar to 3-ketoacyl-CoA thiolase (Fragment).
MEKAIDRQRVLLAHLLPSSSSDQSLLSASACAAGDSAAYQRTSAYGDDVVVVAAYRTPIC
KAKRGGFKDTYPEDLLTVVLKAVLDNTKINPGEIGDIVVGTVLGPGSQRAIECRAAAFYA
GVPENVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMSVNAMGWEGQVNPKV
NEVQKAQDCLLPMGITSENVAHRYGVTRQEQDQAAAESHRRAAAATAAGKFKDEIVPVPT
KIVDPKTGEEKKVVISVDDGIRPGTTASGLAKLKPVFRKDGTTTAGNSSQVSDGAGAVLL
MRRDVAMKKGLPILGVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLQIEDIDLFELNEA
FASQFVYCCNKLGLDRSKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGRDCRFGVVT
MCIGSGMGAAAVFERGDSVDQFSNVRHH*

5'UTR

chr02:35085070..35085196 (- strand) : 127 bp

CDS

chr02:35084989..35085069 (- strand) : 81 bp

chr02:35084804..35084880 (- strand) : 77 bp

chr02:35084130..35084214 (- strand) : 85 bp

chr02:35083886..35084012 (- strand) : 127 bp

chr02:35083688..35083786 (- strand) : 99 bp

chr02:35083518..35083585 (- strand) : 68 bp

chr02:35083328..35083435 (- strand) : 108 bp

chr02:35083161..35083238 (- strand) : 78 bp

chr02:35082882..35083014 (- strand) : 133 bp

chr02:35082664..35082760 (- strand) : 97 bp

chr02:35082071..35082194 (- strand) : 124 bp

chr02:35081874..35081982 (- strand) : 109 bp

chr02:35081645..35081728 (- strand) : 84 bp

chr02:35081449..35081525 (- strand) : 77 bp

3'UTR

chr02:35080879..35081448 (- strand) : 570 bp

FASTA

>Os02t0817700-02 class=Sequence position=chr02:35080879..35085196 (- strand)
AAGTAATCGG CGCTTTCGCG AGAGAGAGCG ATACGAACAA GAGAAAATCT TCTCCAGACA CCGCGGCGGG CTTCCCCACC
CCATCGGAAG GAAGAAGACG ACCAGCTCGC GCGCTCGGAT CTCAGCCATG GAGAAGGCGA TCGATCGCCA GCGCGTCCTC
CTCGCCCACC TCCTCCCCTC CTCCTCCTCC GACCAATCGC TCCTCTCCGT GAGTCAATTC CTCTTCCTCT CTCTCGCAAT
TCTCTTTGTA ATCTCCATCT CTCTCTCTCT CTCTCACTGG ACTCAATTCA ATTCGATTGT TGGTTGATTG GTTCAGGCGT
CGGCGTGCGC CGCCGGGGAC AGCGCCGCCT ACCAGAGGAC TTCCGCCTAC GGGGACGACG TCGTCGTCGT CGCGTAAGCT
TTTACATCCC TAATCCCTTT TTTTTTCCTA CTACTACCTG TTATTACTTA CACGGAACAC CAATTAAGGT CACCTGTTAA
TGGCGGATGT TTGACTACCA CTAGTTGCTG CCATGTTTGA GGAATAGTAG TAAATTCAAG CAACTGCGCT GATTGACTTT
TCTTACGAAT CAGGATTACT GTAGGTGCTT GGTATCGCGA TGTACGCCCA TCCAAGTCAA ATGCGTTTTG TTGAAGTTAA
CCTCTTTAGT TTTAGGATAA ACCTTGTACT AGTAGCTGAA ATCATACTAA ATCAAGAGTT TGTTACCCCC GCAAAAAAAA
AAGAAGAGTT TGTTACTGCT ATTTTGCAAC AAGATAAAAG ATCGCAAACT CTACAAGTCA ATTCTATCTC TTCACCACCT
ATCACCCAAA GTGTATTACA AACTACAAGT TCTAAGCTTT GTTTTTTTTT TAGTGTTTCT TTTTTGGCTG TAGCATGTTT
TGTGTGCTTA GCCATGTGAA TATGCCACCA CGTATCTGAA TCGATCAACG GATGTGATAG ATACTCTTCT AACCACTTTA
TTCCATGTTT ATCCACCTGC AGTGCCTACA GGACACCCAT ATGCAAGGCC AAGCGAGGAG GTTTCAAGGA TACATACCCA
GAGGACCTTC TTACTGTTGT TCTAAAGGTT TGCGCCTGCT AATATTGCCC TTCATGTATG CTGTGATTCA GTGGTTACTT
CGAATTTAGA GACTATGCGT TCTCAATCAA TCGTTTGCTC CTTTTTTTTC TATGTATTTT CTAGGCTGTT CTGGACAACA
CTAAGATCAA CCCTGGTGAA ATTGGTGACA TTGTAGTTGG CACGGTGCTA GGTCCAGGCT CGCAGCGTGC AATCGAGTGC
AGGGCTGCGG CTTTCTATGC TGGAGTTCCC GGTAATACTG TGTTTGCGGT TATATCACCA TATGAAGACA GGGCTTCTTT
ATTATGGACA CTGGTTTCAT TTGCTTGATT TTACTTTTCT GTCGATGCAG AAAACGTTCC TGTTAGAACT GTCAACCGGC
AATGTTCCTC TGGATTACAG GCAGTGGCTG ATGTTGCCGC GGCCATTAAA GCTGGGTTCT ACGACATAGG TAATTAACTA
GTTACTCGTT CTAGACAATA TGGTTATGCT AACTCTGCTA CATGGTTGCT TCATTTAAAG GTGCTAATTT GTCTTTTTCC
ATCAAAAACA GGGATTGGTG CAGGCCTGGA ATCCATGTCA GTAAATGCTA TGGGTTGGGA AGGACAAGTA AACCCTAAAG
TATGAATTCT ATGAGCACCA GAGCATCCTC TGTATTTCTG TTGTTCTCTG GTGATGCCTT GTAACACCAC GTACTTTGTA
GGTAAATGAA GTCCAGAAAG CACAGGATTG TCTTTTGCCC ATGGGGATAA CGTCCGAAAA TGTTGCGCAC CGATATGGTG
TAACAAGACA AGAGCAGGAT CAGGCTGCTG TGAGTCACTT GCATACATTC TGTTTGTGTT TTTTCTTCCC ACTGCTTCCT
TTTACTCAAA ACACTGTCGA AATTTTTGTT TTTAACAGGC TGAGTCTCAT AGGAGGGCTG CTGCAGCCAC AGCTGCTGGG
AAATTCAAAG ATGAGATTGT TCCGGTGCCT ACAAAGGTAA GAGGCTCTGG GATTTAGTTC ATGTGATGTA ACCTAGTTTA
TTGTTCATGG TTATTGTTGA CTCATGAATG GTTGTTGTCA CTGGATTTTT CTTTTGCTAA TCAGGACCTG TGCAAGGTTC
ACTGATATTC TTTCCTGTGC AGATTGTTGA CCCCAAGACT GGAGAGGAAA AGAAAGTTGT GATATCAGTT GATGATGGAA
TTAGGCCAGG GACCACAGCA TCTGGATTGG CAAAGCTTAA ACCAGTTTTC CGGAAGGATG GTACCACAAC TGCAGGTATT
GCAGCACTCT TAGCTTTTTT TTCTGCTGAC ACTACTATTG CAACCAGGCT TTGTTTGTCC ATTGCTTGTT ACATTGTGTA
TGTGTTTTTT TTTTTTAATT TAACGAATCT ATGTAGGCAA CTCTAGTCAA GTGAGCGATG GTGCTGGAGC TGTTCTTCTC
ATGAGGAGGG ACGTAGCGAT GAAGAAGGGA CTTCCTATTC TTGGTGTTTT CAGGTGCTGC ATTTTGCATT TCCTTGTATA
TACAGCATTT GGTTCAGTCT TAACATGTGT TCCTGAATGC TGTATGAGAT Actccctcta ttccaaaata taaggcacaa
ccacccttaa cccaaagacc aagaaataat tattatcatc ttgtagtttg gatcatccta ataaatataa tgcatgcatc
caataggatt agatagcatg agagtggagg atttaaaaaa gtaataattt aatggagaag atgtcatagt taattgcatg
tttgcatgta taccttatat tatggaacat ctaagaaaag tggttgtgcc ttatattatg gaatggaggg agTGTATCTT
ATTGTTAGGT GTGAACGGAG TTTGTGATCA TCATTGTTAT TGCTATTGCT GTTGGGACCT AATATATTAT CACATTTTCT
TTTAACTGAT CCATCCATAT GTTGCCTCCA ATCATCATTT AGGAGCTTTG CTGCTGTTGG AGTAGATCCT GCTGTTATGG
GTGTTGGTCC TGCAGTAGCA ATACCAGCTG CAGTGAAGTC TGCTGGACTC CAGATTGAAG ACATTGATCT GTTTGAATTG
AATGAGGTTT GTTACTTTTT ACAATATTAG CTCACTCGTT TACTCGTACC TAGCTACAAT GGTTGATACC CATGCCATCT
GTATTCTTGT ATAGGCCTTC GCTTCGCAGT TCGTGTATTG CTGCAACAAG CTGGGACTGG ACAGGTCAAA AGTAAACGTG
AATGGAGGCG CAATCGCCCT AGGACATCCT CTTGGTGCAA CAGGTAATCA AATACTTGTA TGGGAGATCG TCATTCTGGC
TTTAGAATGT GCAGGTGTCA ATGGAAGTAG CATTGCTGTC TGTTAGTACC TGCTACAGAT CATCCAAGCA TGTCTTCTAA
ATGGGGTGAT TGTTCCTCTG TTGGTCAGGT GCCCGGTGCG TCGCAACTCT TCTGAATGAA ATGAAGCGCC GGGGCAGGGA
CTGCAGATTC GGTGTTGTCA CCATGTGCAT TGGTGAGTTC TTTTTCTCTG GATTTCTCTG TGTGCAGGAG AATGCATGCA
AGTAGCCCTC GTTGTTAAAC TTCCATGACA TCTTGTGTAC TAGTATGTAA CTATGCATGA ATTGGTTGCA GGATCTGGCA
TGGGGGCAGC AGCTGTGTTT GAGCGGGGTG ACTCGGTCGA CCAATTCTCA AACGTGCGCC ACCATTAGCG GCAGTTTTCT
AAGAGAAATG CAAAGCAAAG CAGTGGTGCA AAATCATCAT GGTGGTCAGT CCAATGGAGC ATACTCTGGC AGTAAGATCT
ATACCGAAAA CTAAATGCAG GAAACACGTA ATCTTCTCCG GTGAAAGGTG TAACAGTATA TTGAAGATCT TTTCATGTAA
CATTTTGCAC TAATAATAAT TTATGCGAAT AAGGGGCATG CATGCTCAAT GTTTGTTTTG TCAAGTGTTC CACACGAAAC
ACTGAGAGGA GCACAGTGGT TGCAAATGTT GAAGGGCCTG ATAAGGGTAG GCCTGATCAT GGATAATTTG GCCCAAATCA
AATCTGGCCT GGCCTGATCG TTGTCCAAAA TACTTAGTAC TACTTTCTCT GTAAAAAAAT AATACAGTAT AAAACAATTT
ATTTTGCTTG TTAGGACAAT GCTTTAATCA CCAACTGCTT TATTAATATA TTATATTTAT GTGACACAGA AGTATAATTA
CAGGAAAGCA TTTGTGAATA TAAATCTAAT AGCACTCATT ACTTTTGAAT GTAAATCTAA TGACATTAAT TTTGTCTC