Os02t0817800-01

Locus

Os02g0817800

Description

Similar to Telomere binding protein-1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RTBP1

CGSNL Gene Name

TELOMERE BINDING PROTEIN 1

Oryzabase Gene Symbol Synonym(s)

rtbp1, TBP1, OsTBP1

Oryzabase Gene Name Synonym(s)

RICE TELOMERE BINDING PROTEIN 1, Telomere Binding Protein 1, Telomere-binding protein 1, Protein RTBP1, rice telomere-binding protein 1, telomere binding protein-1

Transcript Evidence

AK068473 (DDBJ, Best hit)

Protein Evidence

Q9LL45 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J013157F01 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0817800-01)

RiceXPro (AK068473)

Others

Oryzabase (7473)

KEGG (Os02t0817800-01)

Transcript

3182 bp

>Os02t0817800-01 Similar to Telomere binding protein-1.
ACGGGGTTTTTCTCCTCCAATCCTTTCCCCTCTCCCTCTCCTCCTCCTCCTCCTCCCTGC
GCCTTCCACTTGCAGCGATTCCTCCTCCCCGCCCGCTCTTCTCGAACCTTCTGGAACCTT
CCCCCATCCCCCACAAGAAGCAGCAGATGGGCATCGTCGTCGTCGTCGTCAACCAATCCT
AGGCGACGAGCGCTGCGGCGGCGCGCGCCATCTGCTCCCCTCCGCCGTGCTCCGGTGCTC
CCCGATCTGCGCCTCCCGCTCCGGTTGGTCGGCTGTCGGAACACGCAGCTGCAAAACCCT
AGCCGAGCTGCGGCGATCTCAACGCTGGCGGCGAGGCCCTCCTCTTCGTCGGCGTCGACG
GAAAAATATGGCGCATGTTTTATTTACTTCCCCTTGCTGTCACTGAACACATTTCCTAAA
GTCAAGGACAAGACATGGTGTTGCAGAAGAGGTTGGACTATGGATCCCATGGCCATCGTG
CTCCCATTAAGCCACGTGTCGCAACATTGGCGCCGGTTAAACGCTCCACAAGAATAAGGA
AAAAGCAGATGTATGCACTTGATTTGCTTGCGACAGCTGCAGAAAAATTGTTGGCTGATC
AAGACAATTTATCTAGTGGACCTAACATAAATGAAACACCAGAAGGTTATGTTACAAGCA
TGAAACCAGTTAAAGCAGAACAGTTTGATGAAGCGTTTCCGTTGAGAAGCGTGGCTGTGA
AAAAAGATGACTGCAAAGGTTGTACAGTAGGCTGTGCAGGCATCTGTGGCTTTCTCAGAC
AAGCTAATATGTGCTTGGCTGAAAACTCGTCGACTCAAAATCTAGCTGATTCAGTACTAG
AGTCACTAACAGCAAAGCCTGATGTGTTGGCTAAGGACTCATTTGTTAGCAGTAAAAAAT
CATGTCGATTGGGTTTTGGTCTTGGCACAATTCCGGAGTATGGATCTGTTGGAGTATGCC
AACCTTGGTCCACAAGATCAGCAGAGGTTAAACAAGTGCATCGGGCGAGACCAACAGCAA
TCAGAAGTCAAGAAGATAGTGATGCTGCAGCTCTATGTGCTTTGGTCGAGACCATGGATT
TGGACACCAAACCTCTTGCTGAGGCTAGCTCTGGTAGTAACTCAGGAGTGCACATCTGCG
GCCCTGACAGGGGGCATAACTCCCATCCCTCGTGTTTGGCTAAAGTGCAGCATGCTGCAG
ACAGAGATGATGACGAAAATTCTTCTGGGTGTGTACATCCAAGCACCTCAGGAAATAACC
GTGGTTATATTCCACATTATATAGGTGACCGCAGGATAAGGAGATTGTTTGCCTCCAGGT
TAAGGAAGGCAGCTCGCAACAGGATATGTGGAGAGATGTCTTGTAAAGGTAACAAGCTGA
GTTTGTGTGAAAAGAAGATGCCCACTACGCGCCGAAGAGTGCAACAAACAACTTTGAAGA
GGAAAAGACTTGCTCAACTTTACTCCGAAAAATCATCTGATGAAGGTATCCTAACTGAAA
GTATTTTTTGATAATGGAAGCTTTATTAAAAACTCAGATCCTAACTGAAAGTATGTATTG
TGTTGTCCGTTTCCCTTATTGTATCTAAAGGTCACAAATTATTTAGATTGCTCCAGGATG
TAACATTGCACATAGTTGGTACGACTTAATCCTTCTTACACACAGCATTGGATATTCTGA
ACCCCTGCTTTGATACACTTCCTAAAAATACACGGGCATGCCATTTCTGCCAGTGGAACT
CCATTTTGTATGGGTGATCCAAATCCGCATGTGCATCTGAGGGCTATGATGGCGTCCTGG
ATGTTTATTTTAGTTTTGGGGTTGACTTAAAAGAATCATTGCTTAATTTATAAACACAAT
GACTTACTTTTTTCTCTCTTTTCAGTCAAGTTAACCATCAAATCTTTCAACATCCCTGAA
CTACTAATTGAGATCCCTGAAAATGCAACAGTTGGTTCATTGAAGAAAACTGTGTCAGAT
GCTGTTACTACTATAATTGAACGCGGTCTCCGTGTCGGTATACTTCTTCAAGGAAAAAAT
ATTCAAAATGACAACAAGACGCTTCGTCAGGCTGGGATTTGCCGTGGTAAAAAACTAAAT
GACATAGGCTTTACTCTGGAATGTGAAGCTGGGCAAGATTCTCACCCTGGTGTAATAGTG
CCAGAAGAAATGGATTTTGTTGGTGCATCTGTTGTGGACAAGTCTGCTACGTAGGTTACA
AGAAAGCATCTTCTCCTTGCATTATTAGACAGGAGGCTTGGATTTACATGTGATGATTAG
AAAACATTGTCAGGATGCATCTGATAGTTTATGTCAACGTTGTTGTTTTGCAGAAGTTTC
GGAAACTACACGACCATAGATTTTTGCTGTATGTGGTCATCTAAGGGTTTTAATATTCCA
TTTCCAGGGTGAAATGCGAAGAACCTGCTGAGAACCAGCAGCTTATGCAAGATTTTCCAG
GCTGCAGCTTGAGTGATCCTGGTTCTGTTGATTATCCCGTGGAATGGAGCACACAAGAAA
CATCAGCAAGCTCCCAAGCCATCGTCCCTTTTGCAGATCCAAACTCACTGGCGCTGGCCA
ATGTGCCGCTTTCTAGGTCAAAGCGACCAGATTTTGGGCAAAGACGGATAAGGAGGCCTT
TCACTGTTGCTGAAGTGGAGTTGCTGGTGGAAGCCGTCGAGCACCTTGGAACAGGAAGGT
GGAGGGACGTCAAATTCCGCGCATTTGAAAATGTTCATCATAGGACCTATGTTGATCTGA
AGGACAAGTGGAAGACCCTGGTGCACACGGCGAGCATAGCGCCGCAGCAAAGAAGGGGAG
CTCCAGTTCCACAGGAACTCCTGGACCGTGTGCTCGCCGCACAGGCCTACTGGTCGGAGC
AGCAGGCAAAGCTCCATGGCGATCCCCCTGTTCCTGAAATCTGCCCTACCTGATCCTGAT
GATGATTGATGGAGAAGGCAAGAATGGCCCTCGTGTACAAATCGGTGTAAAAATTGTTCA
GAAGGGATTGGTTGGTTGACGTTTGATTGAAATTTGTCGACAGTTGAAAACTCACAACTT
GGTCCTTCCTACTGTTGGTTCGTTAACAGGAGGAGGAAGAAGAAGAAGAAGAAGAAGAAG
AAGCTTATTTGTAAATTTCAGCAGAGTTTACTGTCTTTGCAAAAATGCAAGTCGTTTTGG
AC

CDS

1077 bp

>Os02t0817800-01 Similar to Telomere binding protein-1.
ATGGTGTTGCAGAAGAGGTTGGACTATGGATCCCATGGCCATCGTGCTCCCATTAAGCCA
CGTGTCGCAACATTGGCGCCGGTTAAACGCTCCACAAGAATAAGGAAAAAGCAGATGTAT
GCACTTGATTTGCTTGCGACAGCTGCAGAAAAATTGTTGGCTGATCAAGACAATTTATCT
AGTGGACCTAACATAAATGAAACACCAGAAGGTTATGTTACAAGCATGAAACCAGTTAAA
GCAGAACAGTTTGATGAAGCGTTTCCGTTGAGAAGCGTGGCTGTGAAAAAAGATGACTGC
AAAGGTTGTACAGTAGGCTGTGCAGGCATCTGTGGCTTTCTCAGACAAGCTAATATGTGC
TTGGCTGAAAACTCGTCGACTCAAAATCTAGCTGATTCAGTACTAGAGTCACTAACAGCA
AAGCCTGATGTGTTGGCTAAGGACTCATTTGTTAGCAGTAAAAAATCATGTCGATTGGGT
TTTGGTCTTGGCACAATTCCGGAGTATGGATCTGTTGGAGTATGCCAACCTTGGTCCACA
AGATCAGCAGAGGTTAAACAAGTGCATCGGGCGAGACCAACAGCAATCAGAAGTCAAGAA
GATAGTGATGCTGCAGCTCTATGTGCTTTGGTCGAGACCATGGATTTGGACACCAAACCT
CTTGCTGAGGCTAGCTCTGGTAGTAACTCAGGAGTGCACATCTGCGGCCCTGACAGGGGG
CATAACTCCCATCCCTCGTGTTTGGCTAAAGTGCAGCATGCTGCAGACAGAGATGATGAC
GAAAATTCTTCTGGGTGTGTACATCCAAGCACCTCAGGAAATAACCGTGGTTATATTCCA
CATTATATAGGTGACCGCAGGATAAGGAGATTGTTTGCCTCCAGGTTAAGGAAGGCAGCT
CGCAACAGGATATGTGGAGAGATGTCTTGTAAAGGTAACAAGCTGAGTTTGTGTGAAAAG
AAGATGCCCACTACGCGCCGAAGAGTGCAACAAACAACTTTGAAGAGGAAAAGACTTGCT
CAACTTTACTCCGAAAAATCATCTGATGAAGGTATCCTAACTGAAAGTATTTTTTGA

Protein

359 aa

>Os02t0817800-01 Similar to Telomere binding protein-1.
MVLQKRLDYGSHGHRAPIKPRVATLAPVKRSTRIRKKQMYALDLLATAAEKLLADQDNLS
SGPNINETPEGYVTSMKPVKAEQFDEAFPLRSVAVKKDDCKGCTVGCAGICGFLRQANMC
LAENSSTQNLADSVLESLTAKPDVLAKDSFVSSKKSCRLGFGLGTIPEYGSVGVCQPWST
RSAEVKQVHRARPTAIRSQEDSDAAALCALVETMDLDTKPLAEASSGSNSGVHICGPDRG
HNSHPSCLAKVQHAADRDDDENSSGCVHPSTSGNNRGYIPHYIGDRRIRRLFASRLRKAA
RNRICGEMSCKGNKLSLCEKKMPTTRRRVQQTTLKRKRLAQLYSEKSSDEGILTESIF*

5'UTR

chr02:35090516..35090652 (- strand) : 137 bp

chr02:35090156..35090379 (- strand) : 224 bp

chr02:35089669..35089741 (- strand) : 73 bp

CDS

chr02:35089588..35089668 (- strand) : 81 bp

chr02:35088657..35089509 (- strand) : 853 bp

chr02:35088371..35088513 (- strand) : 143 bp

3'UTR

chr02:35087917..35088370 (- strand) : 454 bp

chr02:35086774..35087506 (- strand) : 733 bp

chr02:35086611..35086674 (- strand) : 64 bp

chr02:35086090..35086509 (- strand) : 420 bp

FASTA

>Os02t0817800-01 class=Sequence position=chr02:35086090..35090652 (- strand)
ACGGGGTTTT TCTCCTCCAA TCCTTTCCCC TCTCCCTCTC CTCCTCCTCC TCCTCCCTGC GCCTTCCACT TGCAGCGATT
CCTCCTCCCC GCCCGCTCTT CTCGAACCTT CTGGAACCTT CCCCCATCCC CCACAAGGTT ACCCTTCTTG ATCGGACAAC
CTGCCTGATT ATTTCATTTT ATTTCCTGCT CTGATTATCT CCTGTATGTT TTCAAGAAAA GGAGAAAAAA ATGGAAACTT
ATATGCAAAA TTCGTTTCTT GTATGCACAG CAGAAGCAGC AGATGGGCAT CGTCGTCGTC GTCGTCAACC AATCCTAGGC
GACGAGCGCT GCGGCGGCGC GCGCCATCTG CTCCCCTCCG CCGTGCTCCG GTGCTCCCCG ATCTGCGCCT CCCGCTCCGG
TTGGTCGGCT GTCGGAACAC GCAGCTGCAA AACCCTAGCC GAGCTGCGGC GATCTCAACG CTGGCGGCGA GGCCCTCCTC
TTCGTCGGCG TCGACGGGTA ATGCGGATTC TTCCCTCTCG TCAGTTACGC GAGATGCTCG ATTGCATTTC GGGATGGGGT
TTATGCTCTA GGTGTGAACC GAATAATTGC CGAGCCGAAA CATGTTTGAT TCGGTTTGTG TATACACAGA TCTAGCCAGA
CAACATCATC TCAGATGTCG GGGTGGGGTG TAGAGCACAC CATCAACCCC AATTTGTCCT TTTTAAGAGC AAAGATATAC
TACTACAAGT AGACTGTGGT TTCAGCGAAT GTCATCTTGC CAGATATTAT CGGTTTTGAT GGGGCTCACC AATGATGAAT
TCTTTCCATT TCAGAAGCAT AGAATTCAGC ATTTTCTTTT AGTTGTGAGC TGTATTAGGA TGTCTTTCGG TATTGGATCA
ATGTTCGCTA AATCTTGCTT ATTCGACGCA GAAAAATATG GCGCATGTTT TATTTACTTC CCCTTGCTGT CACTGAACAC
ATTTCCTAAA GTCAAGGACA AGACATGGTG TTGCAGAAGA GGTTGGACTA TGGATCCCAT GGCCATCGTG CTCCCATTAA
GCCACGTGTC GCAACATTGG CGCCGGTACA TTTTTGTTAT GTTCTTATGT TAAGTGTGCT ACCCACATAA TTTGGTAAGT
TTTAATGATC GATTGTAATT CAGGTTAAAC GCTCCACAAG AATAAGGAAA AAGCAGATGT ATGCACTTGA TTTGCTTGCG
ACAGCTGCAG AAAAATTGTT GGCTGATCAA GACAATTTAT CTAGTGGACC TAACATAAAT GAAACACCAG AAGGTTATGT
TACAAGCATG AAACCAGTTA AAGCAGAACA GTTTGATGAA GCGTTTCCGT TGAGAAGCGT GGCTGTGAAA AAAGATGACT
GCAAAGGTTG TACAGTAGGC TGTGCAGGCA TCTGTGGCTT TCTCAGACAA GCTAATATGT GCTTGGCTGA AAACTCGTCG
ACTCAAAATC TAGCTGATTC AGTACTAGAG TCACTAACAG CAAAGCCTGA TGTGTTGGCT AAGGACTCAT TTGTTAGCAG
TAAAAAATCA TGTCGATTGG GTTTTGGTCT TGGCACAATT CCGGAGTATG GATCTGTTGG AGTATGCCAA CCTTGGTCCA
CAAGATCAGC AGAGGTTAAA CAAGTGCATC GGGCGAGACC AACAGCAATC AGAAGTCAAG AAGATAGTGA TGCTGCAGCT
CTATGTGCTT TGGTCGAGAC CATGGATTTG GACACCAAAC CTCTTGCTGA GGCTAGCTCT GGTAGTAACT CAGGAGTGCA
CATCTGCGGC CCTGACAGGG GGCATAACTC CCATCCCTCG TGTTTGGCTA AAGTGCAGCA TGCTGCAGAC AGAGATGATG
ACGAAAATTC TTCTGGGTGT GTACATCCAA GCACCTCAGG AAATAACCGT GGTTATATTC CACATTATAT AGGTGACCGC
AGGATAAGGA GATTGTTTGC CTCCAGGTTA AGGAAGGCAG CTCGCAACAG GATATGTGGA GAGATGTCTT GTAAAGGTAT
TTCAAGCTAA TATCATCTCT TCTACAGCTC CATAGCTTGT GAAAAGAGAG GATACTTTCT TTTCCTACTT AATTTTATTT
TTCAGCTAGT TAGCAGGATT TGGACTTTAT ATTGACCAAG TTTTTTATCA TTTAACTAGG TAACAAGCTG AGTTTGTGTG
AAAAGAAGAT GCCCACTACG CGCCGAAGAG TGCAACAAAC AACTTTGAAG AGGAAAAGAC TTGCTCAACT TTACTCCGAA
AAATCATCTG ATGAAGGTAT CCTAACTGAA AGTATTTTTT GATAATGGAA GCTTTATTAA AAACTCAGAT CCTAACTGAA
AGTATGTATT GTGTTGTCCG TTTCCCTTAT TGTATCTAAA GGTCACAAAT TATTTAGATT GCTCCAGGAT GTAACATTGC
ACATAGTTGG TACGACTTAA TCCTTCTTAC ACACAGCATT GGATATTCTG AACCCCTGCT TTGATACACT TCCTAAAAAT
ACACGGGCAT GCCATTTCTG CCAGTGGAAC TCCATTTTGT ATGGGTGATC CAAATCCGCA TGTGCATCTG AGGGCTATGA
TGGCGTCCTG GATGTTTATT TTAGTTTTGG GGTTGACTTA AAAGAATCAT TGCTTAATTT ATAAACACAA TGACTTACTT
TTTTCTCTCT TTTCAGTCAA GTTAACCATC AAATCTTTCA ACATCCCTGA ACTACTAATT GAGATCCCTG AAAATGCAAC
AGTTGGTTCA TTGAAGGTAA AACACCATAT GTGTATCTTC TCAGTAAAAG TTATTGGCTG TAACATATAT TTATTAGTTG
GCAACCATGT ATTCATGTGT GCATCCTGAT ACTCTTTCCA TTTGCTGTCA ATAATCTTAG TATCGTTAGT GTTATCCTGT
GTCAGCTGTT TTGGAAACTC AAATATATCA AGTATTTGCT GCTCTGTGAT CCATGCTAAT GTGTATTTGA CTGATCTAGT
TTTCTAGTTT TAGTGATGCA ACGTACTTAT ACATAGTGAA AAGGTGGTGC CTTTTCGTTA CACTTATTTT AATCTTATAT
ATGTTGAATA TTTCTGCCTG TCAGTGCTTT ACACTTAAAT ATTTATCTCT GTGCATAGAC ATTGGCTTTC TTATGAACCA
CATTATTTCT TTCTATTTGT CTTCAGAAAA CTGTGTCAGA TGCTGTTACT ACTATAATTG AACGCGGTCT CCGTGTCGGT
ATACTTCTTC AAGGAAAAAA TATTCAAAAT GACAACAAGA CGCTTCGTCA GGCTGGGATT TGCCGTGGTA AAAAACTAAA
TGACATAGGC TTTACTCTGG AATGTGAAGC TGGGCAAGAT TCTCACCCTG GTGTAATAGT GCCAGAAGAA ATGGATTTTG
TTGGTGCATC TGTTGTGGAC AAGTCTGCTA CGTAGGTTAC AAGAAAGCAT CTTCTCCTTG CATTATTAGA CAGGAGGCTT
GGATTTACAT GTGATGATTA GAAAACATTG TCAGGATGCA TCTGATAGTT TATGTCAACG TTGTTGTTTT GCAGAAGTTT
CGGAAACTAC ACGACCATAG ATTTTTGCTG TATGTGGTCA TCTAAGGGTT TTAATATTCC ATTTCCAGGG TGAAATGCGA
AGAACCTGCT GAGAACCAGC AGCTTATGCA AGATTTTCCA GGCTGCAGCT TGAGTGATCC TGGTTCTGTT GATTATCCCG
TGGAATGGAG CACACAAGAA ACATCAGCAA GCTCCCAAGC CATCGTCCCT TTTGCAGATC CAAACTCACT GGCGCTGGCC
AATGTGCCGC TTTCTAGGTC AAAGCGACCA GATTTTGGGC AAAGACGGAT AAGGAGGCCT TTCACTGTTG CTGAAGTGGA
GTTGCTGGTG GAAGCCGTCG AGCACCTTGG AACAGGAAGG TTTGTGGCTT CAATGCCCCA GTAGTTTTAT TCCTATAGGC
ACGAGATCAT CACCGCAGTT CGCGTGTCTC ATGTGGACCT CTTGATCTGG TTGTCTAGGT GGAGGGACGT CAAATTCCGC
GCATTTGAAA ATGTTCATCA TAGGACCTAT GTTGATCTGA AGGTAAGCCT AAATCTATCT CGTTTTTTCT TCAGATCTGC
CTCTTTCTAT CAGGATCAGG ATGCACTATC TGAAAACCTG TGAAACAATA TTTGATGAAC CAGGACAAGT GGAAGACCCT
GGTGCACACG GCGAGCATAG CGCCGCAGCA AAGAAGGGGA GCTCCAGTTC CACAGGAACT CCTGGACCGT GTGCTCGCCG
CACAGGCCTA CTGGTCGGAG CAGCAGGCAA AGCTCCATGG CGATCCCCCT GTTCCTGAAA TCTGCCCTAC CTGATCCTGA
TGATGATTGA TGGAGAAGGC AAGAATGGCC CTCGTGTACA AATCGGTGTA AAAATTGTTC AGAAGGGATT GGTTGGTTGA
CGTTTGATTG AAATTTGTCG ACAGTTGAAA ACTCACAACT TGGTCCTTCC TACTGTTGGT TCGTTAACAG GAGGAGGAAG
AAGAAGAAGA AGAAGAAGAA GAAGCTTATT TGTAAATTTC AGCAGAGTTT ACTGTCTTTG CAAAAATGCA AGTCGTTTTG
GAC

Locus: Os02g0817800

Loading...

Locus: Os02g0817800

Loading...