Os02t0817800-02

Locus

Os02g0817800

Description

Similar to Telomere binding protein-1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RTBP1

CGSNL Gene Name

TELOMERE BINDING PROTEIN 1

Oryzabase Gene Symbol Synonym(s)

rtbp1, TBP1, OsTBP1

Oryzabase Gene Name Synonym(s)

RICE TELOMERE BINDING PROTEIN 1, Telomere Binding Protein 1, Telomere-binding protein 1, Protein RTBP1, rice telomere-binding protein 1, telomere binding protein-1

Transcript Evidence

AK100685 (DDBJ, Best hit)

Protein Evidence

Q9LL45 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J023113M24 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0817800-02)

RiceXPro (AK100685)

Others

Oryzabase (7473)

KEGG (Os02t0817800-02)

Transcript

2926 bp

>Os02t0817800-02 Similar to Telomere binding protein-1.
GGGGTTTTTCTCCTCCAATCCTTTCCCCTCTCCCTCTCCTCCTCCTCCTCCTCCCTGCGC
CTTCCACTTGCAGCGATTCCTCCTCCCCGCCCGCTCTTCTCGAACCTTCTGGAACCTTCC
CCCATCCCCCACAAGAAGCAGCAGATGGGCATCGTCGTCGTCGTCGTCAACCAATCCTAG
GCGACGAGCGCTGCGGCGGCGCGCGCCATCTGCTCCCCTCCGCCGTGCTCCGGTGCTCCC
CGATCTGCGCCTCCCGCTCCGGTTGGTCGGCTGTCGGAACACGCAGCTGCAAAACCCTAG
CCGAGCTGCGGCGATCTCAACGCTGGCGGCGAGGCCCTCCTCTTCGTCGGCGTCGACGGA
AAAATATGGCGCATGTTTTATTTACTTCCCCTTGCTGTCACTGAACACATTTCCTAAAGT
CAAGGACAAGACATGGTGTTGCAGAAGAGGTTGGACTATGGATCCCATGGCCATCGTGCT
CCCATTAAGCCACGTGTCGCAACATTGGCGCCGGTTAAACGCTCCACAAGAATAAGGAAA
AAGCAGATGTATGCACTTGATTTGCTTGCGACAGCTGCAGAAAAATTGTTGGCTGATCAA
GACAATTTATCTAGTGGACCTAACATAAATGAAACACCAGAAGGTTATGTTACAAGCATG
AAACCAGTTAAAGCAGAACAGTTTGATGAAGCGTTTCCGTTGAGAAGCGTGGCTGTGAAA
AAAGATGACTGCAAAGGTTGTACAGTAGGCTGTGCAGGCATCTGTGGCTTTCTCAGACAA
GCTAATATGTGCTTGGCTGAAAACTCGTCGACTCAAAATCTAGCTGATTCAGTACTAGAG
TCACTAACAGCAAAGCCTGATGTGTTGGCTAAGGACTCATTTGTTAGCAGTAAAAAATCA
TGTCGATTGGGTTTTGGTCTTGGCACAATTCCGGAGTATGGATCTGTTGGAGTATGCCAA
CCTTGGTCCACAAGATCAGCAGAGGTTAAACAAGTGCATCGGGCGAGACCAACAGCAATC
AGAAGTCAAGAAGATAGTGATGCTGCAGCTCTATGTGCTTTGGTCGAGACCATGGATTTG
GACACCAAACCTCTTGCTGAGGCTAGCTCTGGTAGTAACTCAGGAGTGCACATCTGCGGC
CCTGACAGGGGGCATAACTCCCATCCCTCGTGTTTGGCTAAAGTGCAGCATGCTGCAGAC
AGAGATGATGACGAAAATTCTTCTGGGTGTGTACATCCAAGCACCTCAGGAAATAACCGT
GGTTATATTCCACATTATATAGGTGACCGCAGGATAAGGAGATTGTTTGCCTCCAGGTTA
AGGAAGGCAGCTCGCAACAGGATATGTGGAGAGATGTCTTGTAAAGGTAACAAGCTGAGT
TTGTGTGAAAAGAAGATGCCCACTACGCGCCGAAGAGTGCAACAAACAACTTTGAAGAGG
AAAAGACTTGCTCAACTTTACTCCGAAAAATCATCTGATGAAGAAAACTGTGTCAGATGC
TGTTACTACTATAATTGAACGCGGTCTCCGTGTCGGTATACTTCTTCAAGGAAAAAATAT
TCAAAATGACAACAAGACGCTTCGTCAGGCTGGGATTTGCCGTGGTAAAAAACTAAATGA
CATAGGCTTTACTCTGGAATGTGAAGCTGGGCAAGATTCTCACCCTGGTGTAATAGTGCC
AGAAGAAATGGATTTTGTTGGTGCATCTGTTGTGGACAAGTCTGCTACGGTGAAATGCGA
AGAACCTGCTGAGAACCAGCAGCTTATGCAAGATTTTCCAGGCTGCAGCTTGAGTGATCC
TGGTTCTGTTGATTATCCCGTGGAATGGAGCACACAAGAAACATCAGCAAGCTCCCAAGC
CATCGTCCCTTTTGCAGATCCAAACTCACTGGCGCTGGCCAATGTGCCGCTTTCTAGGTC
AAAGCGACCAGATTTTGGGCAAAGACGGATAAGGAGGCCTTTCACTGTTGCTGAAGTGGA
GTTGCTGGTGGAAGCCGTCGAGCACCTTGGAACAGGAAGGTGGAGGGACGTCAAATTCCG
CGCATTTGAAAATGTTCATCATAGGACCTATGTTGATCTGAAGGACAAGTGGAAGACCCT
GGTGCACACGGCGAGCATAGCGCCGCAGCAAAGAAGGGGAGCTCCAGTTCCACAGGAACT
CCTGGACCGTGTGCTCGCCGCACAGGCCTACTGGTCGGAGCAGCAGGCAAAGCTCCATGG
CGATCCCCCTGTTCCTGAAATCTGCCCTACCTGATCCTGATGATGATTGATGGAGAAGGC
AAGAATGGCCCTCGTGTACAAATCGGTGTAAAAATTGTTCAGAAGGGATTGGTTGGTTGA
CGTTTGATTGAAATTTGTCGACAGTTGAAAACTCACAACTTGGTCCTTCCTACTGTTGGT
TCGTTAACAGGAGGAGGAAGAAGAAGAAGAAGAAGAAGAAGAAGCTTATTTGTAAATTTC
AGCAGAGTTTACTGTCTTTGCAAAAATGCAAGTCGTTTTGGACAAGTTGAGCTGGTTTTT
GCATTTGCTTGGACGTGATCCTGGCTGGGCCGTTGTGATGATGAGGTGAGGCCCAAGCCC
ATGAAACAAGATGGGCTTTGTCATCGTGGGAAGCAGACCTTGGCTGTTACGGCTGCTGTT
GTCTTTATCTACCGGCCTGGCCTTCTTATCCAACTGCAACTAACACCAACCGGCCAGCTG
CCGTCAGGCCTGACGTCAGCACAAGCATGGAAGCAGACGAACTCCACGTTTAGCTCCATC
AGACCATCACCATTCGGCGCGGATTCTCGATTAGCATGTGCACTCGTATCATCACAATTA
gagcaagttcaatagaatagccaaccgttggctctaaatcatctataactaatataatag
tttattcatacaatagttatctataaaaatatactgcaccattaat

CDS

1086 bp

>Os02t0817800-02 Similar to Telomere binding protein-1.
ATGGTGTTGCAGAAGAGGTTGGACTATGGATCCCATGGCCATCGTGCTCCCATTAAGCCA
CGTGTCGCAACATTGGCGCCGGTTAAACGCTCCACAAGAATAAGGAAAAAGCAGATGTAT
GCACTTGATTTGCTTGCGACAGCTGCAGAAAAATTGTTGGCTGATCAAGACAATTTATCT
AGTGGACCTAACATAAATGAAACACCAGAAGGTTATGTTACAAGCATGAAACCAGTTAAA
GCAGAACAGTTTGATGAAGCGTTTCCGTTGAGAAGCGTGGCTGTGAAAAAAGATGACTGC
AAAGGTTGTACAGTAGGCTGTGCAGGCATCTGTGGCTTTCTCAGACAAGCTAATATGTGC
TTGGCTGAAAACTCGTCGACTCAAAATCTAGCTGATTCAGTACTAGAGTCACTAACAGCA
AAGCCTGATGTGTTGGCTAAGGACTCATTTGTTAGCAGTAAAAAATCATGTCGATTGGGT
TTTGGTCTTGGCACAATTCCGGAGTATGGATCTGTTGGAGTATGCCAACCTTGGTCCACA
AGATCAGCAGAGGTTAAACAAGTGCATCGGGCGAGACCAACAGCAATCAGAAGTCAAGAA
GATAGTGATGCTGCAGCTCTATGTGCTTTGGTCGAGACCATGGATTTGGACACCAAACCT
CTTGCTGAGGCTAGCTCTGGTAGTAACTCAGGAGTGCACATCTGCGGCCCTGACAGGGGG
CATAACTCCCATCCCTCGTGTTTGGCTAAAGTGCAGCATGCTGCAGACAGAGATGATGAC
GAAAATTCTTCTGGGTGTGTACATCCAAGCACCTCAGGAAATAACCGTGGTTATATTCCA
CATTATATAGGTGACCGCAGGATAAGGAGATTGTTTGCCTCCAGGTTAAGGAAGGCAGCT
CGCAACAGGATATGTGGAGAGATGTCTTGTAAAGGTAACAAGCTGAGTTTGTGTGAAAAG
AAGATGCCCACTACGCGCCGAAGAGTGCAACAAACAACTTTGAAGAGGAAAAGACTTGCT
CAACTTTACTCCGAAAAATCATCTGATGAAGAAAACTGTGTCAGATGCTGTTACTACTAT
AATTGA

Protein

362 aa

>Os02t0817800-02 Similar to Telomere binding protein-1.
MVLQKRLDYGSHGHRAPIKPRVATLAPVKRSTRIRKKQMYALDLLATAAEKLLADQDNLS
SGPNINETPEGYVTSMKPVKAEQFDEAFPLRSVAVKKDDCKGCTVGCAGICGFLRQANMC
LAENSSTQNLADSVLESLTAKPDVLAKDSFVSSKKSCRLGFGLGTIPEYGSVGVCQPWST
RSAEVKQVHRARPTAIRSQEDSDAAALCALVETMDLDTKPLAEASSGSNSGVHICGPDRG
HNSHPSCLAKVQHAADRDDDENSSGCVHPSTSGNNRGYIPHYIGDRRIRRLFASRLRKAA
RNRICGEMSCKGNKLSLCEKKMPTTRRRVQQTTLKRKRLAQLYSEKSSDEENCVRCCYYY
N*

5'UTR

chr02:35090516..35090650 (- strand) : 135 bp

chr02:35090156..35090379 (- strand) : 224 bp

chr02:35089669..35089741 (- strand) : 73 bp

CDS

chr02:35089588..35089668 (- strand) : 81 bp

chr02:35088657..35089509 (- strand) : 853 bp

chr02:35088397..35088513 (- strand) : 117 bp

chr02:35087472..35087506 (- strand) : 35 bp

3'UTR

chr02:35087262..35087471 (- strand) : 210 bp

chr02:35086774..35087064 (- strand) : 291 bp

chr02:35086611..35086674 (- strand) : 64 bp

chr02:35085667..35086509 (- strand) : 843 bp

FASTA

>Os02t0817800-02 class=Sequence position=chr02:35085667..35090650 (- strand)
GGGGTTTTTC TCCTCCAATC CTTTCCCCTC TCCCTCTCCT CCTCCTCCTC CTCCCTGCGC CTTCCACTTG CAGCGATTCC
TCCTCCCCGC CCGCTCTTCT CGAACCTTCT GGAACCTTCC CCCATCCCCC ACAAGGTTAC CCTTCTTGAT CGGACAACCT
GCCTGATTAT TTCATTTTAT TTCCTGCTCT GATTATCTCC TGTATGTTTT CAAGAAAAGG AGAAAAAAAT GGAAACTTAT
ATGCAAAATT CGTTTCTTGT ATGCACAGCA GAAGCAGCAG ATGGGCATCG TCGTCGTCGT CGTCAACCAA TCCTAGGCGA
CGAGCGCTGC GGCGGCGCGC GCCATCTGCT CCCCTCCGCC GTGCTCCGGT GCTCCCCGAT CTGCGCCTCC CGCTCCGGTT
GGTCGGCTGT CGGAACACGC AGCTGCAAAA CCCTAGCCGA GCTGCGGCGA TCTCAACGCT GGCGGCGAGG CCCTCCTCTT
CGTCGGCGTC GACGGGTAAT GCGGATTCTT CCCTCTCGTC AGTTACGCGA GATGCTCGAT TGCATTTCGG GATGGGGTTT
ATGCTCTAGG TGTGAACCGA ATAATTGCCG AGCCGAAACA TGTTTGATTC GGTTTGTGTA TACACAGATC TAGCCAGACA
ACATCATCTC AGATGTCGGG GTGGGGTGTA GAGCACACCA TCAACCCCAA TTTGTCCTTT TTAAGAGCAA AGATATACTA
CTACAAGTAG ACTGTGGTTT CAGCGAATGT CATCTTGCCA GATATTATCG GTTTTGATGG GGCTCACCAA TGATGAATTC
TTTCCATTTC AGAAGCATAG AATTCAGCAT TTTCTTTTAG TTGTGAGCTG TATTAGGATG TCTTTCGGTA TTGGATCAAT
GTTCGCTAAA TCTTGCTTAT TCGACGCAGA AAAATATGGC GCATGTTTTA TTTACTTCCC CTTGCTGTCA CTGAACACAT
TTCCTAAAGT CAAGGACAAG ACATGGTGTT GCAGAAGAGG TTGGACTATG GATCCCATGG CCATCGTGCT CCCATTAAGC
CACGTGTCGC AACATTGGCG CCGGTACATT TTTGTTATGT TCTTATGTTA AGTGTGCTAC CCACATAATT TGGTAAGTTT
TAATGATCGA TTGTAATTCA GGTTAAACGC TCCACAAGAA TAAGGAAAAA GCAGATGTAT GCACTTGATT TGCTTGCGAC
AGCTGCAGAA AAATTGTTGG CTGATCAAGA CAATTTATCT AGTGGACCTA ACATAAATGA AACACCAGAA GGTTATGTTA
CAAGCATGAA ACCAGTTAAA GCAGAACAGT TTGATGAAGC GTTTCCGTTG AGAAGCGTGG CTGTGAAAAA AGATGACTGC
AAAGGTTGTA CAGTAGGCTG TGCAGGCATC TGTGGCTTTC TCAGACAAGC TAATATGTGC TTGGCTGAAA ACTCGTCGAC
TCAAAATCTA GCTGATTCAG TACTAGAGTC ACTAACAGCA AAGCCTGATG TGTTGGCTAA GGACTCATTT GTTAGCAGTA
AAAAATCATG TCGATTGGGT TTTGGTCTTG GCACAATTCC GGAGTATGGA TCTGTTGGAG TATGCCAACC TTGGTCCACA
AGATCAGCAG AGGTTAAACA AGTGCATCGG GCGAGACCAA CAGCAATCAG AAGTCAAGAA GATAGTGATG CTGCAGCTCT
ATGTGCTTTG GTCGAGACCA TGGATTTGGA CACCAAACCT CTTGCTGAGG CTAGCTCTGG TAGTAACTCA GGAGTGCACA
TCTGCGGCCC TGACAGGGGG CATAACTCCC ATCCCTCGTG TTTGGCTAAA GTGCAGCATG CTGCAGACAG AGATGATGAC
GAAAATTCTT CTGGGTGTGT ACATCCAAGC ACCTCAGGAA ATAACCGTGG TTATATTCCA CATTATATAG GTGACCGCAG
GATAAGGAGA TTGTTTGCCT CCAGGTTAAG GAAGGCAGCT CGCAACAGGA TATGTGGAGA GATGTCTTGT AAAGGTATTT
CAAGCTAATA TCATCTCTTC TACAGCTCCA TAGCTTGTGA AAAGAGAGGA TACTTTCTTT TCCTACTTAA TTTTATTTTT
CAGCTAGTTA GCAGGATTTG GACTTTATAT TGACCAAGTT TTTTATCATT TAACTAGGTA ACAAGCTGAG TTTGTGTGAA
AAGAAGATGC CCACTACGCG CCGAAGAGTG CAACAAACAA CTTTGAAGAG GAAAAGACTT GCTCAACTTT ACTCCGAAAA
ATCATCTGAT GAAGGTATCC TAACTGAAAG TATTTTTTGA TAATGGAAGC TTTATTAAAA ACTCAGATCC TAACTGAAAG
TATGTATTGT GTTGTCCGTT TCCCTTATTG TATCTAAAGG TCACAAATTA TTTAGATTGC TCCAGGATGT AACATTGCAC
ATAGTTGGTA CGACTTAATC CTTCTTACAC ACAGCATTGG ATATTCTGAA CCCCTGCTTT GATACACTTC CTAAAAATAC
ACGGGCATGC CATTTCTGCC AGTGGAACTC CATTTTGTAT GGGTGATCCA AATCCGCATG TGCATCTGAG GGCTATGATG
GCGTCCTGGA TGTTTATTTT AGTTTTGGGG TTGACTTAAA AGAATCATTG CTTAATTTAT AAACACAATG ACTTACTTTT
TTCTCTCTTT TCAGTCAAGT TAACCATCAA ATCTTTCAAC ATCCCTGAAC TACTAATTGA GATCCCTGAA AATGCAACAG
TTGGTTCATT GAAGGTAAAA CACCATATGT GTATCTTCTC AGTAAAAGTT ATTGGCTGTA ACATATATTT ATTAGTTGGC
AACCATGTAT TCATGTGTGC ATCCTGATAC TCTTTCCATT TGCTGTCAAT AATCTTAGTA TCGTTAGTGT TATCCTGTGT
CAGCTGTTTT GGAAACTCAA ATATATCAAG TATTTGCTGC TCTGTGATCC ATGCTAATGT GTATTTGACT GATCTAGTTT
TCTAGTTTTA GTGATGCAAC GTACTTATAC ATAGTGAAAA GGTGGTGCCT TTTCGTTACA CTTATTTTAA TCTTATATAT
GTTGAATATT TCTGCCTGTC AGTGCTTTAC ACTTAAATAT TTATCTCTGT GCATAGACAT TGGCTTTCTT ATGAACCACA
TTATTTCTTT CTATTTGTCT TCAGAAAACT GTGTCAGATG CTGTTACTAC TATAATTGAA CGCGGTCTCC GTGTCGGTAT
ACTTCTTCAA GGAAAAAATA TTCAAAATGA CAACAAGACG CTTCGTCAGG CTGGGATTTG CCGTGGTAAA AAACTAAATG
ACATAGGCTT TACTCTGGAA TGTGAAGCTG GGCAAGATTC TCACCCTGGT GTAATAGTGC CAGAAGAAAT GGATTTTGTT
GGTGCATCTG TTGTGGACAA GTCTGCTACG TAGGTTACAA GAAAGCATCT TCTCCTTGCA TTATTAGACA GGAGGCTTGG
ATTTACATGT GATGATTAGA AAACATTGTC AGGATGCATC TGATAGTTTA TGTCAACGTT GTTGTTTTGC AGAAGTTTCG
GAAACTACAC GACCATAGAT TTTTGCTGTA TGTGGTCATC TAAGGGTTTT AATATTCCAT TTCCAGGGTG AAATGCGAAG
AACCTGCTGA GAACCAGCAG CTTATGCAAG ATTTTCCAGG CTGCAGCTTG AGTGATCCTG GTTCTGTTGA TTATCCCGTG
GAATGGAGCA CACAAGAAAC ATCAGCAAGC TCCCAAGCCA TCGTCCCTTT TGCAGATCCA AACTCACTGG CGCTGGCCAA
TGTGCCGCTT TCTAGGTCAA AGCGACCAGA TTTTGGGCAA AGACGGATAA GGAGGCCTTT CACTGTTGCT GAAGTGGAGT
TGCTGGTGGA AGCCGTCGAG CACCTTGGAA CAGGAAGGTT TGTGGCTTCA ATGCCCCAGT AGTTTTATTC CTATAGGCAC
GAGATCATCA CCGCAGTTCG CGTGTCTCAT GTGGACCTCT TGATCTGGTT GTCTAGGTGG AGGGACGTCA AATTCCGCGC
ATTTGAAAAT GTTCATCATA GGACCTATGT TGATCTGAAG GTAAGCCTAA ATCTATCTCG TTTTTTCTTC AGATCTGCCT
CTTTCTATCA GGATCAGGAT GCACTATCTG AAAACCTGTG AAACAATATT TGATGAACCA GGACAAGTGG AAGACCCTGG
TGCACACGGC GAGCATAGCG CCGCAGCAAA GAAGGGGAGC TCCAGTTCCA CAGGAACTCC TGGACCGTGT GCTCGCCGCA
CAGGCCTACT GGTCGGAGCA GCAGGCAAAG CTCCATGGCG ATCCCCCTGT TCCTGAAATC TGCCCTACCT GATCCTGATG
ATGATTGATG GAGAAGGCAA GAATGGCCCT CGTGTACAAA TCGGTGTAAA AATTGTTCAG AAGGGATTGG TTGGTTGACG
TTTGATTGAA ATTTGTCGAC AGTTGAAAAC TCACAACTTG GTCCTTCCTA CTGTTGGTTC GTTAACAGGA GGAGGAAGAA
GAAGAAGAAG AAGAAGAAGA AGCTTATTTG TAAATTTCAG CAGAGTTTAC TGTCTTTGCA AAAATGCAAG TCGTTTTGGA
CAAGTTGAGC TGGTTTTTGC ATTTGCTTGG ACGTGATCCT GGCTGGGCCG TTGTGATGAT GAGGTGAGGC CCAAGCCCAT
GAAACAAGAT GGGCTTTGTC ATCGTGGGAA GCAGACCTTG GCTGTTACGG CTGCTGTTGT CTTTATCTAC CGGCCTGGCC
TTCTTATCCA ACTGCAACTA ACACCAACCG GCCAGCTGCC GTCAGGCCTG ACGTCAGCAC AAGCATGGAA GCAGACGAAC
TCCACGTTTA GCTCCATCAG ACCATCACCA TTCGGCGCGG ATTCTCGATT AGCATGTGCA CTCGTATCAT CACAATTAga
gcaagttcaa tagaatagcc aaccgttggc tctaaatcat ctataactaa tataatagtt tattcataca atagttatct
ataaaaatat actgcaccat taat

Locus: Os02g0817800

Loading...

Locus: Os02g0817800

Loading...