Os02t0817800-03

Locus

Os02g0817800

Description

Telomere binding protein , Establishing and /or maintaining an active telomere configuration

RAP-DB Gene Symbol Synonym(s)

RTBP1, rtbp1, TBP1, OsTBP1

RAP-DB Gene Name Synonym(s)

TELOMERE BINDING PROTEIN 1, RICE TELOMERE BINDING PROTEIN 1, Telomere Binding Protein 1, Telomere-binding protein 1, Protein RTBP1, rice telomere-binding protein 1, telomere binding protein-1

CGSNL Gene Symbol

RTBP1

CGSNL Gene Name

TELOMERE BINDING PROTEIN 1

Oryzabase Gene Symbol Synonym(s)

rtbp1, TBP1, OsTBP1

Oryzabase Gene Name Synonym(s)

RICE TELOMERE BINDING PROTEIN 1, Telomere Binding Protein 1, Telomere-binding protein 1, Protein RTBP1, rice telomere-binding protein 1, telomere binding protein-1

Transcript Evidence

AF242298 (Dongjin)

Protein Evidence

Q9LL45

Literature

PMID: 10811811

PMID: 17586654

PMID: 19152316

Note

Manual Curation

November 9, 2009

Gene Ontology (GO)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: chromatin binding (GO:0003682)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Ubiquitin-related domain (IPR029071)

Ubiquitin-like (IPR000626)

Homeodomain-like (IPR009057)

SANT/Myb domain (IPR001005)

Myb domain (IPR017930)

Others

Oryzabase (7473)

Transcript

2028 bp

>Os02t0817800-03 Telomere binding protein , Establishing  and /or maintaining an active telomere configuration
CACATTTCCTAAAGTCAAGGACAAGACATGGTGTTGCAGAAGAGGTTGGACTATGGATCC
CATGGCCATCGTGCTCCCATTAAGCCACGTGTCGCAACATTGGCGCCGGTTAAACGCTCC
ACAAGAATAAGGAAAAAGCAGATGTATGCACTTGATTTGCTTGCGACAGCTGCAGAAAAA
TTGTTGGCTGATCAAGACAATTTATCTAGTGGACCTAACATAAATGAAACACCAGAAGGT
TATGTTACAAGCATGAAACCAGTTAAAGCAGAACAGTTTGATGAAGCGTTTCCGTTGAGA
AGCGTGGCTGTGAAAAAAGATGACTGCAAAGGTTGTACAGTAGGCTGTGCAGGCATCTGT
GGCTTTCTCAGACAAGCTAATATGTGCTTGGCTGAAAACTCGTCGACTCAAAATCTAGCT
GATTCAGTACTAGAGTCACTAACAGCAAAGCCTGATGTGTTGGCTAAGGACTCATTTGTT
AGCAGTAAAAAATCATGTCGATTGGGTTTTGGTCTTGGCACAATTCCGGAGTATGGATCT
GTTGGAGTATGCCAACCTTGGTCCACAAGATCAGCAGAGGTTAAACAAGTGCATCGGGCG
AGACCAACAGCAATCAGAAGTCAAGAAGATAGTGATGCTGCAGCTCTATGTGCTTTGGTC
GAGACCATGGATTTGGACACCAAACCTCTTGCTGAGGCTAGCTCTGGTAGTAACTCAGGA
GTGCACATCTGCGGCCCTGACAGGGGGCATAACTCCCATCCCTCGTGTTTGGCTAAAGTG
CAGCATGCTGCAGACAGAGATGATGACGAAAATTCTTCTGGGTGTGTACATCCAAGCACC
TCAGGAAATAACCGTGGTTATATTCCACATTATATAGGTGACCGCAGGATAAGGAGATTG
TTTGCCTCCAGGTTAAGGAAGGCAGCTCGCAACAGGATATGTGGAGAGATGTCTTGTAAA
GGTAACAAGCTGAGTTTGTGTGAAAAGAAGATGCCCACTACGCGCCGAAGAGTGCAACAA
ACAACTTTGAAGAGGAAAAGACTTGCTCAACTTTACTCCGAAAAATCATCTGATGAAGTC
AAGTTAACCATCAAATCTTTCAACATCCCTGAACTACTAATTGAGATCCCTGAAAATGCA
ACAGTTGGTTCATTGAAGAAAACTGTGTCAGATGCTGTTACTACTATAATTGAACGCGGT
CTCCGTGTCGGTATACTTCTTCAAGGAAAAAATATTCAAAATGACAACAAGACGCTTCGT
CAGGCTGGGATTTGCCGTGGTAAAAAACTAAATGACATAGGCTTTACTCTGGAATGTGAA
GCTGGGCAAGATTCTCACCCTGGTGTAATAGTGCCAGAAGAAATGGATTTTGTTGGTGCA
TCTGTTGTGGACAAGTCTGCTACGGTGAAATGCGAAGAACCTGCTGAGAACCAGCAGCTT
ATGCAAGATTTTCCAGGCTGCAGCTTGAGTGATCCTGGTTCTGTTGATTATCCCGTGGAA
TGGAGCACACAAGAAACATCAGCAAGCTCCCAAGCCATCGTCCCTTTTGCAGATCCAAAC
TCACTGGCGCTGGCCAATGTGCCGCTTTCTAGGTCAAAGCGACCAGATTTTGGGCAAAGA
CGGATAAGGAGGCCTTTCACTGTTGCTGAAGTGGAGTTGCTGGTGGAAGCCGTCGAGCAC
CTTGGAACAGGAAGGTGGAGGGACGTCAAATTCCGCGCATTTGAAAATGTTCATCATAGG
ACCTATGTTGATCTGAAGGACAAGTGGAAGACCCTGGTGCACACGGCGAGCATAGCGCCG
CAGCAAAGAAGGGGAGCTCCAGTTCCACAGGAACTCCTGGACCGTGTGCTCGCCGCACAG
GCCTACTGGTCGGAGCAGCAGGCAAAGCTCCATGGCGATCCCCCTGTTCCTGAAATCTGC
CCTACCTGATCCTGATGATGATTGATGGAGAAGGCAAGAATGGCCCTCGTGTACAAATCG
GTGTAAAAATTGTTCAGAAGGGATTGGTTGGTTGACGTTTGATTGAAA

CDS

1902 bp

>Os02t0817800-03 Telomere binding protein , Establishing  and /or maintaining an active telomere configuration
ATGGTGTTGCAGAAGAGGTTGGACTATGGATCCCATGGCCATCGTGCTCCCATTAAGCCA
CGTGTCGCAACATTGGCGCCGGTTAAACGCTCCACAAGAATAAGGAAAAAGCAGATGTAT
GCACTTGATTTGCTTGCGACAGCTGCAGAAAAATTGTTGGCTGATCAAGACAATTTATCT
AGTGGACCTAACATAAATGAAACACCAGAAGGTTATGTTACAAGCATGAAACCAGTTAAA
GCAGAACAGTTTGATGAAGCGTTTCCGTTGAGAAGCGTGGCTGTGAAAAAAGATGACTGC
AAAGGTTGTACAGTAGGCTGTGCAGGCATCTGTGGCTTTCTCAGACAAGCTAATATGTGC
TTGGCTGAAAACTCGTCGACTCAAAATCTAGCTGATTCAGTACTAGAGTCACTAACAGCA
AAGCCTGATGTGTTGGCTAAGGACTCATTTGTTAGCAGTAAAAAATCATGTCGATTGGGT
TTTGGTCTTGGCACAATTCCGGAGTATGGATCTGTTGGAGTATGCCAACCTTGGTCCACA
AGATCAGCAGAGGTTAAACAAGTGCATCGGGCGAGACCAACAGCAATCAGAAGTCAAGAA
GATAGTGATGCTGCAGCTCTATGTGCTTTGGTCGAGACCATGGATTTGGACACCAAACCT
CTTGCTGAGGCTAGCTCTGGTAGTAACTCAGGAGTGCACATCTGCGGCCCTGACAGGGGG
CATAACTCCCATCCCTCGTGTTTGGCTAAAGTGCAGCATGCTGCAGACAGAGATGATGAC
GAAAATTCTTCTGGGTGTGTACATCCAAGCACCTCAGGAAATAACCGTGGTTATATTCCA
CATTATATAGGTGACCGCAGGATAAGGAGATTGTTTGCCTCCAGGTTAAGGAAGGCAGCT
CGCAACAGGATATGTGGAGAGATGTCTTGTAAAGGTAACAAGCTGAGTTTGTGTGAAAAG
AAGATGCCCACTACGCGCCGAAGAGTGCAACAAACAACTTTGAAGAGGAAAAGACTTGCT
CAACTTTACTCCGAAAAATCATCTGATGAAGTCAAGTTAACCATCAAATCTTTCAACATC
CCTGAACTACTAATTGAGATCCCTGAAAATGCAACAGTTGGTTCATTGAAGAAAACTGTG
TCAGATGCTGTTACTACTATAATTGAACGCGGTCTCCGTGTCGGTATACTTCTTCAAGGA
AAAAATATTCAAAATGACAACAAGACGCTTCGTCAGGCTGGGATTTGCCGTGGTAAAAAA
CTAAATGACATAGGCTTTACTCTGGAATGTGAAGCTGGGCAAGATTCTCACCCTGGTGTA
ATAGTGCCAGAAGAAATGGATTTTGTTGGTGCATCTGTTGTGGACAAGTCTGCTACGGTG
AAATGCGAAGAACCTGCTGAGAACCAGCAGCTTATGCAAGATTTTCCAGGCTGCAGCTTG
AGTGATCCTGGTTCTGTTGATTATCCCGTGGAATGGAGCACACAAGAAACATCAGCAAGC
TCCCAAGCCATCGTCCCTTTTGCAGATCCAAACTCACTGGCGCTGGCCAATGTGCCGCTT
TCTAGGTCAAAGCGACCAGATTTTGGGCAAAGACGGATAAGGAGGCCTTTCACTGTTGCT
GAAGTGGAGTTGCTGGTGGAAGCCGTCGAGCACCTTGGAACAGGAAGGTGGAGGGACGTC
AAATTCCGCGCATTTGAAAATGTTCATCATAGGACCTATGTTGATCTGAAGGACAAGTGG
AAGACCCTGGTGCACACGGCGAGCATAGCGCCGCAGCAAAGAAGGGGAGCTCCAGTTCCA
CAGGAACTCCTGGACCGTGTGCTCGCCGCACAGGCCTACTGGTCGGAGCAGCAGGCAAAG
CTCCATGGCGATCCCCCTGTTCCTGAAATCTGCCCTACCTGA

Protein

634 aa

>Os02t0817800-03 Telomere binding protein , Establishing  and /or maintaining an active telomere configuration
MVLQKRLDYGSHGHRAPIKPRVATLAPVKRSTRIRKKQMYALDLLATAAEKLLADQDNLS
SGPNINETPEGYVTSMKPVKAEQFDEAFPLRSVAVKKDDCKGCTVGCAGICGFLRQANMC
LAENSSTQNLADSVLESLTAKPDVLAKDSFVSSKKSCRLGFGLGTIPEYGSVGVCQPWST
RSAEVKQVHRARPTAIRSQEDSDAAALCALVETMDLDTKPLAEASSGSNSGVHICGPDRG
HNSHPSCLAKVQHAADRDDDENSSGCVHPSTSGNNRGYIPHYIGDRRIRRLFASRLRKAA
RNRICGEMSCKGNKLSLCEKKMPTTRRRVQQTTLKRKRLAQLYSEKSSDEVKLTIKSFNI
PELLIEIPENATVGSLKKTVSDAVTTIIERGLRVGILLQGKNIQNDNKTLRQAGICRGKK
LNDIGFTLECEAGQDSHPGVIVPEEMDFVGASVVDKSATVKCEEPAENQQLMQDFPGCSL
SDPGSVDYPVEWSTQETSASSQAIVPFADPNSLALANVPLSRSKRPDFGQRRIRRPFTVA
EVELLVEAVEHLGTGRWRDVKFRAFENVHHRTYVDLKDKWKTLVHTASIAPQQRRGAPVP
QELLDRVLAAQAYWSEQQAKLHGDPPVPEICPT*

5'UTR

chr02:35089669..35089695 (- strand) : 27 bp

CDS

chr02:35089588..35089668 (- strand) : 81 bp

chr02:35088657..35089509 (- strand) : 853 bp

chr02:35088397..35088513 (- strand) : 117 bp

chr02:35087917..35087996 (- strand) : 80 bp

chr02:35087262..35087506 (- strand) : 245 bp

chr02:35086774..35087064 (- strand) : 291 bp

chr02:35086611..35086674 (- strand) : 64 bp

chr02:35086339..35086509 (- strand) : 171 bp

3'UTR

chr02:35086240..35086338 (- strand) : 99 bp

FASTA

>Os02t0817800-03 class=Sequence position=chr02:35086240..35089695 (- strand)
CACATTTCCT AAAGTCAAGG ACAAGACATG GTGTTGCAGA AGAGGTTGGA CTATGGATCC CATGGCCATC GTGCTCCCAT
TAAGCCACGT GTCGCAACAT TGGCGCCGGT ACATTTTTGT TATGTTCTTA TGTTAAGTGT GCTACCCACA TAATTTGGTA
AGTTTTAATG ATCGATTGTA ATTCAGGTTA AACGCTCCAC AAGAATAAGG AAAAAGCAGA TGTATGCACT TGATTTGCTT
GCGACAGCTG CAGAAAAATT GTTGGCTGAT CAAGACAATT TATCTAGTGG ACCTAACATA AATGAAACAC CAGAAGGTTA
TGTTACAAGC ATGAAACCAG TTAAAGCAGA ACAGTTTGAT GAAGCGTTTC CGTTGAGAAG CGTGGCTGTG AAAAAAGATG
ACTGCAAAGG TTGTACAGTA GGCTGTGCAG GCATCTGTGG CTTTCTCAGA CAAGCTAATA TGTGCTTGGC TGAAAACTCG
TCGACTCAAA ATCTAGCTGA TTCAGTACTA GAGTCACTAA CAGCAAAGCC TGATGTGTTG GCTAAGGACT CATTTGTTAG
CAGTAAAAAA TCATGTCGAT TGGGTTTTGG TCTTGGCACA ATTCCGGAGT ATGGATCTGT TGGAGTATGC CAACCTTGGT
CCACAAGATC AGCAGAGGTT AAACAAGTGC ATCGGGCGAG ACCAACAGCA ATCAGAAGTC AAGAAGATAG TGATGCTGCA
GCTCTATGTG CTTTGGTCGA GACCATGGAT TTGGACACCA AACCTCTTGC TGAGGCTAGC TCTGGTAGTA ACTCAGGAGT
GCACATCTGC GGCCCTGACA GGGGGCATAA CTCCCATCCC TCGTGTTTGG CTAAAGTGCA GCATGCTGCA GACAGAGATG
ATGACGAAAA TTCTTCTGGG TGTGTACATC CAAGCACCTC AGGAAATAAC CGTGGTTATA TTCCACATTA TATAGGTGAC
CGCAGGATAA GGAGATTGTT TGCCTCCAGG TTAAGGAAGG CAGCTCGCAA CAGGATATGT GGAGAGATGT CTTGTAAAGG
TATTTCAAGC TAATATCATC TCTTCTACAG CTCCATAGCT TGTGAAAAGA GAGGATACTT TCTTTTCCTA CTTAATTTTA
TTTTTCAGCT AGTTAGCAGG ATTTGGACTT TATATTGACC AAGTTTTTTA TCATTTAACT AGGTAACAAG CTGAGTTTGT
GTGAAAAGAA GATGCCCACT ACGCGCCGAA GAGTGCAACA AACAACTTTG AAGAGGAAAA GACTTGCTCA ACTTTACTCC
GAAAAATCAT CTGATGAAGG TATCCTAACT GAAAGTATTT TTTGATAATG GAAGCTTTAT TAAAAACTCA GATCCTAACT
GAAAGTATGT ATTGTGTTGT CCGTTTCCCT TATTGTATCT AAAGGTCACA AATTATTTAG ATTGCTCCAG GATGTAACAT
TGCACATAGT TGGTACGACT TAATCCTTCT TACACACAGC ATTGGATATT CTGAACCCCT GCTTTGATAC ACTTCCTAAA
AATACACGGG CATGCCATTT CTGCCAGTGG AACTCCATTT TGTATGGGTG ATCCAAATCC GCATGTGCAT CTGAGGGCTA
TGATGGCGTC CTGGATGTTT ATTTTAGTTT TGGGGTTGAC TTAAAAGAAT CATTGCTTAA TTTATAAACA CAATGACTTA
CTTTTTTCTC TCTTTTCAGT CAAGTTAACC ATCAAATCTT TCAACATCCC TGAACTACTA ATTGAGATCC CTGAAAATGC
AACAGTTGGT TCATTGAAGG TAAAACACCA TATGTGTATC TTCTCAGTAA AAGTTATTGG CTGTAACATA TATTTATTAG
TTGGCAACCA TGTATTCATG TGTGCATCCT GATACTCTTT CCATTTGCTG TCAATAATCT TAGTATCGTT AGTGTTATCC
TGTGTCAGCT GTTTTGGAAA CTCAAATATA TCAAGTATTT GCTGCTCTGT GATCCATGCT AATGTGTATT TGACTGATCT
AGTTTTCTAG TTTTAGTGAT GCAACGTACT TATACATAGT GAAAAGGTGG TGCCTTTTCG TTACACTTAT TTTAATCTTA
TATATGTTGA ATATTTCTGC CTGTCAGTGC TTTACACTTA AATATTTATC TCTGTGCATA GACATTGGCT TTCTTATGAA
CCACATTATT TCTTTCTATT TGTCTTCAGA AAACTGTGTC AGATGCTGTT ACTACTATAA TTGAACGCGG TCTCCGTGTC
GGTATACTTC TTCAAGGAAA AAATATTCAA AATGACAACA AGACGCTTCG TCAGGCTGGG ATTTGCCGTG GTAAAAAACT
AAATGACATA GGCTTTACTC TGGAATGTGA AGCTGGGCAA GATTCTCACC CTGGTGTAAT AGTGCCAGAA GAAATGGATT
TTGTTGGTGC ATCTGTTGTG GACAAGTCTG CTACGTAGGT TACAAGAAAG CATCTTCTCC TTGCATTATT AGACAGGAGG
CTTGGATTTA CATGTGATGA TTAGAAAACA TTGTCAGGAT GCATCTGATA GTTTATGTCA ACGTTGTTGT TTTGCAGAAG
TTTCGGAAAC TACACGACCA TAGATTTTTG CTGTATGTGG TCATCTAAGG GTTTTAATAT TCCATTTCCA GGGTGAAATG
CGAAGAACCT GCTGAGAACC AGCAGCTTAT GCAAGATTTT CCAGGCTGCA GCTTGAGTGA TCCTGGTTCT GTTGATTATC
CCGTGGAATG GAGCACACAA GAAACATCAG CAAGCTCCCA AGCCATCGTC CCTTTTGCAG ATCCAAACTC ACTGGCGCTG
GCCAATGTGC CGCTTTCTAG GTCAAAGCGA CCAGATTTTG GGCAAAGACG GATAAGGAGG CCTTTCACTG TTGCTGAAGT
GGAGTTGCTG GTGGAAGCCG TCGAGCACCT TGGAACAGGA AGGTTTGTGG CTTCAATGCC CCAGTAGTTT TATTCCTATA
GGCACGAGAT CATCACCGCA GTTCGCGTGT CTCATGTGGA CCTCTTGATC TGGTTGTCTA GGTGGAGGGA CGTCAAATTC
CGCGCATTTG AAAATGTTCA TCATAGGACC TATGTTGATC TGAAGGTAAG CCTAAATCTA TCTCGTTTTT TCTTCAGATC
TGCCTCTTTC TATCAGGATC AGGATGCACT ATCTGAAAAC CTGTGAAACA ATATTTGATG AACCAGGACA AGTGGAAGAC
CCTGGTGCAC ACGGCGAGCA TAGCGCCGCA GCAAAGAAGG GGAGCTCCAG TTCCACAGGA ACTCCTGGAC CGTGTGCTCG
CCGCACAGGC CTACTGGTCG GAGCAGCAGG CAAAGCTCCA TGGCGATCCC CCTGTTCCTG AAATCTGCCC TACCTGATCC
TGATGATGAT TGATGGAGAA GGCAAGAATG GCCCTCGTGT ACAAATCGGT GTAAAAATTG TTCAGAAGGG ATTGGTTGGT
TGACGTTTGA TTGAAA

Locus: Os02g0817800

Loading...

Locus: Os02g0817800

Loading...