Os02t0822400-01

Locus

Os02g0822400

Description

No apical meristem (NAM) protein domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC70

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 70

Oryzabase Gene Symbol Synonym(s)

ONAC070, ONAC70, OsNTL6, NTL6

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 070, NAC domain-containing protein 70, NAC membrane-bound transcription factor 6, NAC MTF6

Transcript Evidence

AK102173 (DDBJ, Best hit)

Protein Evidence

Q84PC9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

J033086I18 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0822400-01)

RiceXPro (AK102173)

Others

Oryzabase (11495)

KEGG (Os02t0822400-01)

Transcript

2524 bp

>Os02t0822400-01 No apical meristem (NAM) protein domain containing protein.
CTATTATTATTTTCTTTCTCATCACGCGGCTGCGTCCGTATCGCGACTTTTATCCTCTCC
TCCCCAACTAACTCGGCGTTCGCCATCTCGTGTCGACTTCCTCCTCAAAACCCTAATTCC
ATCCACCGCTCGATCCAATCTACCCTCTCTCTCGATTCTCAATTCTCAATTCTCCCTGCA
AAATTCCCAATCCTCCGTGCAGAATTAGAATTATGCGGGATTGATCCCCTCCCACGGGAT
CTCCAATATCATATCCATCCAGAAATTGAAATTCCCCTCGCCGCCGATGAGCCAATCGCC
GCCGGACTcctcctccgcggcggcggtgcccctggcgccggggtttcgcttccaccccac
cgacgaggagctcgtctcctactacctccgccgccgcatcctcggccgccgcctccggat
cgacgccatcgccgaggtcgacctctaccgcctcgagccgtgggacctcccctccctctc
ccgcatccggagccgcgacgcgcagtggtacttcttcgcccgcctcgaccgcaaggtcac
cggcgccggggccggcggccgcggcggccccgggaacaggaccaaccgcgccacgccgcg
cggctactggaagaccaccgggaagGACCGCGATGTccaccaccgcggcaagctcgtcgg
gatgaagaagacgctcgtcttccactccggtagggcgcccaagggccagaggaccaactg
ggtcatgcacgagtaccgcctCCTCGACGCCGACGGCACCCAGGATCTGCATGTGGTGTG
TAGAATCTTCCAGAAAAATGGATCTGGGCCACAAAATGGTGCACAGTACGGTGCGCCATA
CTTGGAGGAAGATTGGGAAGAGGAGGATGATGCAATTGAGAACATGCCTGCCAGTGGCGC
TTTCGCTGAAATGGCTGCAGTCACAGATACTGCAGATGAGTCGACTGAGGAAGATGGGAA
TTTCTCCCTTAAAACTAATGATGAGCCTTTACAAACCCAAGAATACCAGCCAGAGATAAC
TCCTGTGAAAGCTCAAGGTTCAAATGAGGAGACCAATGGCGGTGGTTACAGTTGTGATGT
TTTTTCTCTGGATGAGATTTTGCAGGAACCTGAAAATGTCTGCAAAAATGAAGAGCAGAA
TGCCATTGATGACAAGTTCACTATCGCAGAGTTATCTGGATACCCAAGGCAAGATGATGG
CTATGTAGGCGAGAATGGTCCTGTGAATTGGATTGACCCTTCAAATGGTGATAATACAAA
CTGGCCTTTGAGAGCATATAGTACTCAGAACCATGTCAATGGAACACTTAGCGCTGATGG
TTTCTTTGACACGGTGAATGGTACCAACTCATATTCAGGTCCTTCAGATAACCAGAACCT
GTATTTGCAAGATGATGGCTTGACTTCTTCTCATCAAGTGGGCGATAACATGCCATTTTA
TGACGCATCATCTAATCACAAATGGGTAGATGGAAAGGATGATTATTTGAATTTGAATGA
CCTCCTCTACCCGCCAGCAGAAAATCAACCCCTGTTTGATGCTGGGGATGACCTGATGGC
TTACTTCGATGCCACGGAGGATGATTTCAAATTTGATATTATGGGCACAGAAGATTCTAA
TTCTCAACTTCCAGACATGTCGAACTTTGTCCAAAAGGATGATAACAACAATAAGTTTAC
ATTAGATGGGATCTCTAATACCGCTTTGTATGGTGCTTCTTCATCTGGATCCCATGGCAA
TATGTATCCAGACACTGCAGTACCAGATATGCCGATGGATGACACTGTTGACAAAAGTTT
CGGAAAGCGCCTTGCCAGCATGCTGGGTTCAATTCCAGCTCCACCCGCAATGGCTTCAGA
GTTCCCGCCGAGCACAGGAAAATCTGTTGTCCCACTTAGTGCTGTCAACCCGAGTAGCTC
TATCCGTGTCACTGCAGGCATTATCCAACTCGGTGGTATCACTTTTACTGGTAGCACCGA
GCACCTGCAGAAGAATGGAGATTTCAATTTGCTCCTCTCTTTCACTGTCGAGGGCGACGT
CTCAACCAAATCCATTGGTTTTGAACCGGATACGCAGATGAGCACCACGCCAATGGTGTT
GCGCAGCGGCATGTATCTTTTCTTCGTATCGGCGATGATTCTCATGTTGAGCTACAAAGT
TGGGCTGTGTATCTACAGCAGGTAAGTTATAGTAGTTTTTGTTGCCCCAGGCTGTTTATT
AAATTGAAGGAGTCATACAGAGTCCACTCGACGTAGAGGGAACTGCCTGCGATTTGGACA
GTTTGGTTCTTTACATTGTTATAGTTGGTATACCGTTCTGACAGTTGAAAGATACATAGC
AATAAACTCTGGAATTGGAGAAACTAGAGTTACACGAATTTGGTGCTGAAACTTTTGTTG
GTGGCATGTACTGTATAATTTACTCTATTTATTTATTTCACCCAATTCTGGGAGGCTGTA
AGCGTTCCCCGATCGATGTAAGCTGATCTGAAACCTGAATACGCGCTCTTCATTTTTCAT
ACCC

CDS

1899 bp

>Os02t0822400-01 No apical meristem (NAM) protein domain containing protein.
ATGAGCCAATCGCCGCCGGACTcctcctccgcggcggcggtgcccctggcgccggggttt
cgcttccaccccaccgacgaggagctcgtctcctactacctccgccgccgcatcctcggc
cgccgcctccggatcgacgccatcgccgaggtcgacctctaccgcctcgagccgtgggac
ctcccctccctctcccgcatccggagccgcgacgcgcagtggtacttcttcgcccgcctc
gaccgcaaggtcaccggcgccggggccggcggccgcggcggccccgggaacaggaccaac
cgcgccacgccgcgcggctactggaagaccaccgggaagGACCGCGATGTccaccaccgc
ggcaagctcgtcgggatgaagaagacgctcgtcttccactccggtagggcgcccaagggc
cagaggaccaactgggtcatgcacgagtaccgcctCCTCGACGCCGACGGCACCCAGGAT
CTGCATGTGGTGTGTAGAATCTTCCAGAAAAATGGATCTGGGCCACAAAATGGTGCACAG
TACGGTGCGCCATACTTGGAGGAAGATTGGGAAGAGGAGGATGATGCAATTGAGAACATG
CCTGCCAGTGGCGCTTTCGCTGAAATGGCTGCAGTCACAGATACTGCAGATGAGTCGACT
GAGGAAGATGGGAATTTCTCCCTTAAAACTAATGATGAGCCTTTACAAACCCAAGAATAC
CAGCCAGAGATAACTCCTGTGAAAGCTCAAGGTTCAAATGAGGAGACCAATGGCGGTGGT
TACAGTTGTGATGTTTTTTCTCTGGATGAGATTTTGCAGGAACCTGAAAATGTCTGCAAA
AATGAAGAGCAGAATGCCATTGATGACAAGTTCACTATCGCAGAGTTATCTGGATACCCA
AGGCAAGATGATGGCTATGTAGGCGAGAATGGTCCTGTGAATTGGATTGACCCTTCAAAT
GGTGATAATACAAACTGGCCTTTGAGAGCATATAGTACTCAGAACCATGTCAATGGAACA
CTTAGCGCTGATGGTTTCTTTGACACGGTGAATGGTACCAACTCATATTCAGGTCCTTCA
GATAACCAGAACCTGTATTTGCAAGATGATGGCTTGACTTCTTCTCATCAAGTGGGCGAT
AACATGCCATTTTATGACGCATCATCTAATCACAAATGGGTAGATGGAAAGGATGATTAT
TTGAATTTGAATGACCTCCTCTACCCGCCAGCAGAAAATCAACCCCTGTTTGATGCTGGG
GATGACCTGATGGCTTACTTCGATGCCACGGAGGATGATTTCAAATTTGATATTATGGGC
ACAGAAGATTCTAATTCTCAACTTCCAGACATGTCGAACTTTGTCCAAAAGGATGATAAC
AACAATAAGTTTACATTAGATGGGATCTCTAATACCGCTTTGTATGGTGCTTCTTCATCT
GGATCCCATGGCAATATGTATCCAGACACTGCAGTACCAGATATGCCGATGGATGACACT
GTTGACAAAAGTTTCGGAAAGCGCCTTGCCAGCATGCTGGGTTCAATTCCAGCTCCACCC
GCAATGGCTTCAGAGTTCCCGCCGAGCACAGGAAAATCTGTTGTCCCACTTAGTGCTGTC
AACCCGAGTAGCTCTATCCGTGTCACTGCAGGCATTATCCAACTCGGTGGTATCACTTTT
ACTGGTAGCACCGAGCACCTGCAGAAGAATGGAGATTTCAATTTGCTCCTCTCTTTCACT
GTCGAGGGCGACGTCTCAACCAAATCCATTGGTTTTGAACCGGATACGCAGATGAGCACC
ACGCCAATGGTGTTGCGCAGCGGCATGTATCTTTTCTTCGTATCGGCGATGATTCTCATG
TTGAGCTACAAAGTTGGGCTGTGTATCTACAGCAGGTAA

Protein

633 aa

>Os02t0822400-01 No apical meristem (NAM) protein domain containing protein.
MSQSPPDSSSAAAVPLAPGFRFHPTDEELVSYYLRRRILGRRLRIDAIAEVDLYRLEPWD
LPSLSRIRSRDAQWYFFARLDRKVTGAGAGGRGGPGNRTNRATPRGYWKTTGKDRDVHHR
GKLVGMKKTLVFHSGRAPKGQRTNWVMHEYRLLDADGTQDLHVVCRIFQKNGSGPQNGAQ
YGAPYLEEDWEEEDDAIENMPASGAFAEMAAVTDTADESTEEDGNFSLKTNDEPLQTQEY
QPEITPVKAQGSNEETNGGGYSCDVFSLDEILQEPENVCKNEEQNAIDDKFTIAELSGYP
RQDDGYVGENGPVNWIDPSNGDNTNWPLRAYSTQNHVNGTLSADGFFDTVNGTNSYSGPS
DNQNLYLQDDGLTSSHQVGDNMPFYDASSNHKWVDGKDDYLNLNDLLYPPAENQPLFDAG
DDLMAYFDATEDDFKFDIMGTEDSNSQLPDMSNFVQKDDNNNKFTLDGISNTALYGASSS
GSHGNMYPDTAVPDMPMDDTVDKSFGKRLASMLGSIPAPPAMASEFPPSTGKSVVPLSAV
NPSSSIRVTAGIIQLGGITFTGSTEHLQKNGDFNLLLSFTVEGDVSTKSIGFEPDTQMST
TPMVLRSGMYLFFVSAMILMLSYKVGLCIYSR*

5'UTR

chr02:35303193..35303478 (+ strand) : 286 bp

CDS

chr02:35303479..35303955 (+ strand) : 477 bp

chr02:35304529..35304759 (+ strand) : 231 bp

chr02:35305410..35306072 (+ strand) : 663 bp

chr02:35306205..35306313 (+ strand) : 109 bp

chr02:35306472..35306890 (+ strand) : 419 bp

3'UTR

chr02:35306891..35307229 (+ strand) : 339 bp

FASTA

>Os02t0822400-01 class=Sequence position=chr02:35303193..35307229 (+ strand)
CTATTATTAT TTTCTTTCTC ATCACGCGGC TGCGTCCGTA TCGCGACTTT TATCCTCTCC TCCCCAACTA ACTCGGCGTT
CGCCATCTCG TGTCGACTTC CTCCTCAAAA CCCTAATTCC ATCCACCGCT CGATCCAATC TACCCTCTCT CTCGATTCTC
AATTCTCAAT TCTCCCTGCA AAATTCCCAA TCCTCCGTGC AGAATTAGAA TTATGCGGGA TTGATCCCCT CCCACGGGAT
CTCCAATATC ATATCCATCC AGAAATTGAA ATTCCCCTCG CCGCCGATGA GCCAATCGCC GCCGGACTcc tcctccgcgg
cggcggtgcc cctggcgccg gggtttcgct tccaccccac cgacgaggag ctcgtctcct actacctccg ccgccgcatc
ctcggccgcc gcctccggat cgacgccatc gccgaggtcg acctctaccg cctcgagccg tgggacctcc cctccctctc
ccgcatccgg agccgcgacg cgcagtggta cttcttcgcc cgcctcgacc gcaaggtcac cggcgccggg gccggcggcc
gcggcggccc cgggaacagg accaaccgcg ccacgccgcg cggctactgg aagaccaccg ggaagGACCG CGATGTccac
caccgcggca agctcgtcgg gatgaagaag acgctcgtct tccactccgg tagggcgccc aagggccaga ggaccaactg
ggtcatgcac gagtaccgcc tCCTCGACGC CGACGGCACC CAGGTACCTG TGAAATCATT TGATCCATCT CAAATTTCGC
AGGATCTACC GTACCACGAG ATCACGAGAT TAGCGGTAGC ACCAAAAAAA TTCTGTTCTT TTAGCTTGTC TCCTGCTAGG
CTTGTGTGAG CGGTAGGTGG GAACTGGTCC TATTCTACTT TCAACACTCG TTACTTGCTG CTGCTTAGAT ATGTTATCTA
GTGCGACCCT GTCCCGGGCC TAGAATGGTT ACAACATTCT CATGTTTGTT CACTTGATAC CTATATATGG TAGGTAAAAA
CCTTTCCTTA CAACATCAAT GACTTGCTTT GAGAAAAACC AATATGAGCA TGAGCTTATC TTTTGTCAAT AAAAGAAGAA
AAAAGTGCGA GATGCACTGG TAGAAGTGAT AGAGCACGTC TGGAAATGTA TGAAGCAAGG GGGCTTTTAA CTGGGCTATT
TAAGCATTGG AAATCTTATC CTCACTCTGA ATTGAGGAGT CTGAATTGCG GAGGACCAAT GGTTTTTAAC CTGTATAGAA
TATTGATGTA GCATCCTTTT CTGATAGCTG ATGTTAGTTT CCTGTTGAGT GCGCAGGATC TGCATGTGGT GTGTAGAATC
TTCCAGAAAA ATGGATCTGG GCCACAAAAT GGTGCACAGT ACGGTGCGCC ATACTTGGAG GAAGATTGGG AAGAGGAGGA
TGATGCAATT GAGAACATGC CTGCCAGTGG CGCTTTCGCT GAAATGGCTG CAGTCACAGA TACTGCAGAT GAGTCGACTG
AGGAAGATGG GAATTTCTCC CTTAAAACTA ATGATGAGCC TTTACAAGTA agtactccct ccatcccata atataaggga
ttttgagttt ttgcttgcaa cgtttgacca ctcatcttat tcaaaatttt ttgaaattat taattatttt atttgtgact
tactttatta tctacagtac tttaagcaca acttttcgtt ttttatattt gcaaaaaaat ttgaataaga cgagtggtca
aacgttgcaa gcaaaaactg aaaatccctt atattgtggg acggagggag tagtgcccat TTTCTTTTGT ATTTTCCAAG
ATGTTAGTTA TTAAAAACTG AAATTGTACT GTCAATACTC AACACCTATA ATGAAAACTA GAGGATGCCA GGAATCCATG
GAATTACCTT TAACTGAAAA CATTCTATGT GACTATATCA ATGAATACAG GATAATGATA GCTGAAACAA CTAAGTAGAC
TATGCATTTG CCATCATGGT TGAAGAGTTC TTTTCTTTAA TTAAGGTTTT GCATGTTTCT ATTCCCTGTT ACTGTTCTGA
CAAAATTTTA AAATAGAATA ATTCTTGCTG GATTTTATCT CTTCATATTT TTTTCCTCGA TAATATATTT ATTGCTCCTC
CTATCAAGTG CTCTGTGATG TGTAACACAC CTTCATGTAC TTCAATTACC ACTACAGACC CAAGAATACC AGCCAGAGAT
AACTCCTGTG AAAGCTCAAG GTTCAAATGA GGAGACCAAT GGCGGTGGTT ACAGTTGTGA TGTTTTTTCT CTGGATGAGA
TTTTGCAGGA ACCTGAAAAT GTCTGCAAAA ATGAAGAGCA GAATGCCATT GATGACAAGT TCACTATCGC AGAGTTATCT
GGATACCCAA GGCAAGATGA TGGCTATGTA GGCGAGAATG GTCCTGTGAA TTGGATTGAC CCTTCAAATG GTGATAATAC
AAACTGGCCT TTGAGAGCAT ATAGTACTCA GAACCATGTC AATGGAACAC TTAGCGCTGA TGGTTTCTTT GACACGGTGA
ATGGTACCAA CTCATATTCA GGTCCTTCAG ATAACCAGAA CCTGTATTTG CAAGATGATG GCTTGACTTC TTCTCATCAA
GTGGGCGATA ACATGCCATT TTATGACGCA TCATCTAATC ACAAATGGGT AGATGGAAAG GATGATTATT TGAATTTGAA
TGACCTCCTC TACCCGCCAG CAGAAAATCA ACCCCTGTTT GATGCTGGGG ATGACCTGAT GGCTTACTTC GATGCCACGG
AGGATGATTT CAAATTTGAT ATTATGGGCA CAGAAGATTC TAATTCTCAA CTTCCAGACA TGTCGAACTT TGTCCAAAAG
GTATGCTTCG GTGCACGCAT GTCACATAAC TATGCTACAG TTCTCTTACA TCTAGTTAGA AGGACACTTC CTGATCACTA
TCCTTCTTTG ACTTCTTTCT GGTTATCAAC TGTTGTATTA TTTTCTCTGC AGGATGATAA CAACAATAAG TTTACATTAG
ATGGGATCTC TAATACCGCT TTGTATGGTG CTTCTTCATC TGGATCCCAT GGCAATATGT ATCCAGACAC TGCAGTACCA
GGTATGGCTT TATCACTATA TGCTTATTAG TAACTATTTT CATCTACTAA AGTTTGCCCA TTGCTTTGGG GGTACATACA
AGCATCTTTT ATGAAATGTG ACCATACTTG CATCTAAGTC TCTCTTCTTT AAAAATCTCA TGGAACTACT TTGGTCCAGA
TATGCCGATG GATGACACTG TTGACAAAAG TTTCGGAAAG CGCCTTGCCA GCATGCTGGG TTCAATTCCA GCTCCACCCG
CAATGGCTTC AGAGTTCCCG CCGAGCACAG GAAAATCTGT TGTCCCACTT AGTGCTGTCA ACCCGAGTAG CTCTATCCGT
GTCACTGCAG GCATTATCCA ACTCGGTGGT ATCACTTTTA CTGGTAGCAC CGAGCACCTG CAGAAGAATG GAGATTTCAA
TTTGCTCCTC TCTTTCACTG TCGAGGGCGA CGTCTCAACC AAATCCATTG GTTTTGAACC GGATACGCAG ATGAGCACCA
CGCCAATGGT GTTGCGCAGC GGCATGTATC TTTTCTTCGT ATCGGCGATG ATTCTCATGT TGAGCTACAA AGTTGGGCTG
TGTATCTACA GCAGGTAAGT TATAGTAGTT TTTGTTGCCC CAGGCTGTTT ATTAAATTGA AGGAGTCATA CAGAGTCCAC
TCGACGTAGA GGGAACTGCC TGCGATTTGG ACAGTTTGGT TCTTTACATT GTTATAGTTG GTATACCGTT CTGACAGTTG
AAAGATACAT AGCAATAAAC TCTGGAATTG GAGAAACTAG AGTTACACGA ATTTGGTGCT GAAACTTTTG TTGGTGGCAT
GTACTGTATA ATTTACTCTA TTTATTTATT TCACCCAATT CTGGGAGGCT GTAAGCGTTC CCCGATCGAT GTAAGCTGAT
CTGAAACCTG AATACGCGCT CTTCATTTTT CATACCC

Locus: Os02g0822400

Loading...

Locus: Os02g0822400

Loading...