Os02t0822400-02

Locus

Os02g0822400

Description

Similar to NAC-like protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC70

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 70

Oryzabase Gene Symbol Synonym(s)

ONAC070, ONAC70, OsNTL6, NTL6

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 070, NAC domain-containing protein 70, NAC membrane-bound transcription factor 6, NAC MTF6

Transcript Evidence

AK062258 (DDBJ, Best hit)

Protein Evidence

Q84PC9 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

001-047-G10 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0822400-02)

RiceXPro (AK062258)

Others

Oryzabase (11495)

KEGG (Os02t0822400-02)

Transcript

1669 bp

>Os02t0822400-02 Similar to NAC-like protein.
ATGCCTGCCAGTGGCGCTTTCGCTGAAATGGCTGCAGTCACAGATACTGCAGATGAGTCG
ACTGAGGAAGATGGGAATTTCTCCCTTAAAACTAATGATGAGCCTTTACAAACCCAAGAA
TACCAGCCAGAGATAACTCCTGTGAAAGCTCAAGGTTCAAATGAGGAGACCAATGGCGGT
GGTTACAGTTGTGATGTTTTTTCTCTGGATGAGATTTTGCAGGAACCTGAAAATGTCTGC
AAAAATGAAGAGCAGAATGCCATTGATGACAAGTTCACTATCGCAGAGTTATCTGGATAC
CCAAGGCAAGATGATGGCTATGTAGGCGAGAATGGTCCTGTGAATTGGATTGACCCTTCA
AATGGTGATAATACAAACTGGCCTTTGAGAGCATATAGTACTCAGAACCATGTCAATGGA
ACACTTAGCGCTGATGGTTTCTTTGACACGGTGAATGGTACCAACTCATATTCAGGTCCT
TCAGATAACCAGAACCTGTATTTGCAAGATGATGGCTTGACTTCTTCTCATCAAGTGGGC
GATAACATGCCATTTTATGACGCATCATCTAATCACAAATGGGTAGATGGAAAGGATGAT
TATTTGAATTTGAATGACCTCCTCTACCCGCCAGCAGAAAATCAACCCCTGTTTGATGCT
GGGGATGACCTGATGGCTTACTTCGATGCCACGGAGGATGATTTCAAATTTGATATTATG
GGCACAGAAGATTCTAATTCTCAACTTCCAGACATGTCGAACTTTGTCCAAAAGGATGAT
AACAACAATAAGTTTACATTAGATGGGATCTCTAATACCGCTTTGTATGGTGCTTCTTCA
TCTGGATCCCATGGCAATATGTATCCAGACACTGCAGTACCAGATATGCCGATGGATGAC
ACTGTTGACAAAAGTTTCGGAAAGCGCCTTGCCAGCATGCTGGGTTCAATTCCAGCTCCA
CCCGCAATGGCTTCAGAGTTCCCGCCGAGCACAGGAAAATCTGTTGTCCCACTTAGTGCT
GTCAACCCGAGTAGCTCTATCCGTGTCACTGCAGGCATTATCCAACTCGGTGGTATCACT
TTTACTGGTAGCACCGAGCACCTGCAGAAGAATGGAGATTTCAATTTGCTCCTCTCTTTC
ACTGTCGAGGGCGACGTCTCAACCAAATCCATTGGTTTTGAACCGGATACGCAGATGAGC
ACCACGCCAATGGTGTTGCGCAGCGGCATGTATCTTTTCTTCGTATCGGCGATGATTCTC
ATGTTGAGCTACAAAGTTGGGCTGTGTATCTACAGCAGGTAAGTTATAGTAGTTTTTGTT
GCCCCAGGCTGTTTATTAAATTGAAGGAGTCATACAGAGTCCACTCGACGTAGAGGGAAC
TGCCTGCGATTTGGACAGTTTGGTTCTTTACATTGTTATAGTTGGTATACCGTTCTGACA
GTTGAAAGATACATAGCAATAAACTCTGGAATTGGAGAAACTAGAGTTACACGAATTTGG
TGCTGAAACTTTTGTTGGTGGCATGTACTGTATAATTTACTCTATTTATTTATTTCACCC
AATTCTGGGAGGCTGTAAGCGTTCCCCGATCGATGTAAGCTGATCTGAAACCTGAATACG
CGCTCTTCATTTTTCATACCCAAAGGGCCGAGAGGCACAGTTTGCAGTT

CDS

1302 bp

>Os02t0822400-02 Similar to NAC-like protein.
ATGCCTGCCAGTGGCGCTTTCGCTGAAATGGCTGCAGTCACAGATACTGCAGATGAGTCG
ACTGAGGAAGATGGGAATTTCTCCCTTAAAACTAATGATGAGCCTTTACAAACCCAAGAA
TACCAGCCAGAGATAACTCCTGTGAAAGCTCAAGGTTCAAATGAGGAGACCAATGGCGGT
GGTTACAGTTGTGATGTTTTTTCTCTGGATGAGATTTTGCAGGAACCTGAAAATGTCTGC
AAAAATGAAGAGCAGAATGCCATTGATGACAAGTTCACTATCGCAGAGTTATCTGGATAC
CCAAGGCAAGATGATGGCTATGTAGGCGAGAATGGTCCTGTGAATTGGATTGACCCTTCA
AATGGTGATAATACAAACTGGCCTTTGAGAGCATATAGTACTCAGAACCATGTCAATGGA
ACACTTAGCGCTGATGGTTTCTTTGACACGGTGAATGGTACCAACTCATATTCAGGTCCT
TCAGATAACCAGAACCTGTATTTGCAAGATGATGGCTTGACTTCTTCTCATCAAGTGGGC
GATAACATGCCATTTTATGACGCATCATCTAATCACAAATGGGTAGATGGAAAGGATGAT
TATTTGAATTTGAATGACCTCCTCTACCCGCCAGCAGAAAATCAACCCCTGTTTGATGCT
GGGGATGACCTGATGGCTTACTTCGATGCCACGGAGGATGATTTCAAATTTGATATTATG
GGCACAGAAGATTCTAATTCTCAACTTCCAGACATGTCGAACTTTGTCCAAAAGGATGAT
AACAACAATAAGTTTACATTAGATGGGATCTCTAATACCGCTTTGTATGGTGCTTCTTCA
TCTGGATCCCATGGCAATATGTATCCAGACACTGCAGTACCAGATATGCCGATGGATGAC
ACTGTTGACAAAAGTTTCGGAAAGCGCCTTGCCAGCATGCTGGGTTCAATTCCAGCTCCA
CCCGCAATGGCTTCAGAGTTCCCGCCGAGCACAGGAAAATCTGTTGTCCCACTTAGTGCT
GTCAACCCGAGTAGCTCTATCCGTGTCACTGCAGGCATTATCCAACTCGGTGGTATCACT
TTTACTGGTAGCACCGAGCACCTGCAGAAGAATGGAGATTTCAATTTGCTCCTCTCTTTC
ACTGTCGAGGGCGACGTCTCAACCAAATCCATTGGTTTTGAACCGGATACGCAGATGAGC
ACCACGCCAATGGTGTTGCGCAGCGGCATGTATCTTTTCTTCGTATCGGCGATGATTCTC
ATGTTGAGCTACAAAGTTGGGCTGTGTATCTACAGCAGGTAA

Protein

434 aa

>Os02t0822400-02 Similar to NAC-like protein.
MPASGAFAEMAAVTDTADESTEEDGNFSLKTNDEPLQTQEYQPEITPVKAQGSNEETNGG
GYSCDVFSLDEILQEPENVCKNEEQNAIDDKFTIAELSGYPRQDDGYVGENGPVNWIDPS
NGDNTNWPLRAYSTQNHVNGTLSADGFFDTVNGTNSYSGPSDNQNLYLQDDGLTSSHQVG
DNMPFYDASSNHKWVDGKDDYLNLNDLLYPPAENQPLFDAGDDLMAYFDATEDDFKFDIM
GTEDSNSQLPDMSNFVQKDDNNNKFTLDGISNTALYGASSSGSHGNMYPDTAVPDMPMDD
TVDKSFGKRLASMLGSIPAPPAMASEFPPSTGKSVVPLSAVNPSSSIRVTAGIIQLGGIT
FTGSTEHLQKNGDFNLLLSFTVEGDVSTKSIGFEPDTQMSTTPMVLRSGMYLFFVSAMIL
MLSYKVGLCIYSR*

CDS

chr02:35304649..35304759 (+ strand) : 111 bp

chr02:35305410..35306072 (+ strand) : 663 bp

chr02:35306205..35306313 (+ strand) : 109 bp

chr02:35306472..35306890 (+ strand) : 419 bp

3'UTR

chr02:35306891..35307257 (+ strand) : 367 bp

FASTA

>Os02t0822400-02 class=Sequence position=chr02:35304649..35307257 (+ strand)
ATGCCTGCCA GTGGCGCTTT CGCTGAAATG GCTGCAGTCA CAGATACTGC AGATGAGTCG ACTGAGGAAG ATGGGAATTT
CTCCCTTAAA ACTAATGATG AGCCTTTACA AGTAagtact ccctccatcc cataatataa gggattttga gtttttgctt
gcaacgtttg accactcatc ttattcaaaa ttttttgaaa ttattaatta ttttatttgt gacttacttt attatctaca
gtactttaag cacaactttt cgttttttat atttgcaaaa aaatttgaat aagacgagtg gtcaaacgtt gcaagcaaaa
actgaaaatc ccttatattg tgggacggag ggagtagtgc ccatTTTCTT TTGTATTTTC CAAGATGTTA GTTATTAAAA
ACTGAAATTG TACTGTCAAT ACTCAACACC TATAATGAAA ACTAGAGGAT GCCAGGAATC CATGGAATTA CCTTTAACTG
AAAACATTCT ATGTGACTAT ATCAATGAAT ACAGGATAAT GATAGCTGAA ACAACTAAGT AGACTATGCA TTTGCCATCA
TGGTTGAAGA GTTCTTTTCT TTAATTAAGG TTTTGCATGT TTCTATTCCC TGTTACTGTT CTGACAAAAT TTTAAAATAG
AATAATTCTT GCTGGATTTT ATCTCTTCAT ATTTTTTTCC TCGATAATAT ATTTATTGCT CCTCCTATCA AGTGCTCTGT
GATGTGTAAC ACACCTTCAT GTACTTCAAT TACCACTACA GACCCAAGAA TACCAGCCAG AGATAACTCC TGTGAAAGCT
CAAGGTTCAA ATGAGGAGAC CAATGGCGGT GGTTACAGTT GTGATGTTTT TTCTCTGGAT GAGATTTTGC AGGAACCTGA
AAATGTCTGC AAAAATGAAG AGCAGAATGC CATTGATGAC AAGTTCACTA TCGCAGAGTT ATCTGGATAC CCAAGGCAAG
ATGATGGCTA TGTAGGCGAG AATGGTCCTG TGAATTGGAT TGACCCTTCA AATGGTGATA ATACAAACTG GCCTTTGAGA
GCATATAGTA CTCAGAACCA TGTCAATGGA ACACTTAGCG CTGATGGTTT CTTTGACACG GTGAATGGTA CCAACTCATA
TTCAGGTCCT TCAGATAACC AGAACCTGTA TTTGCAAGAT GATGGCTTGA CTTCTTCTCA TCAAGTGGGC GATAACATGC
CATTTTATGA CGCATCATCT AATCACAAAT GGGTAGATGG AAAGGATGAT TATTTGAATT TGAATGACCT CCTCTACCCG
CCAGCAGAAA ATCAACCCCT GTTTGATGCT GGGGATGACC TGATGGCTTA CTTCGATGCC ACGGAGGATG ATTTCAAATT
TGATATTATG GGCACAGAAG ATTCTAATTC TCAACTTCCA GACATGTCGA ACTTTGTCCA AAAGGTATGC TTCGGTGCAC
GCATGTCACA TAACTATGCT ACAGTTCTCT TACATCTAGT TAGAAGGACA CTTCCTGATC ACTATCCTTC TTTGACTTCT
TTCTGGTTAT CAACTGTTGT ATTATTTTCT CTGCAGGATG ATAACAACAA TAAGTTTACA TTAGATGGGA TCTCTAATAC
CGCTTTGTAT GGTGCTTCTT CATCTGGATC CCATGGCAAT ATGTATCCAG ACACTGCAGT ACCAGGTATG GCTTTATCAC
TATATGCTTA TTAGTAACTA TTTTCATCTA CTAAAGTTTG CCCATTGCTT TGGGGGTACA TACAAGCATC TTTTATGAAA
TGTGACCATA CTTGCATCTA AGTCTCTCTT CTTTAAAAAT CTCATGGAAC TACTTTGGTC CAGATATGCC GATGGATGAC
ACTGTTGACA AAAGTTTCGG AAAGCGCCTT GCCAGCATGC TGGGTTCAAT TCCAGCTCCA CCCGCAATGG CTTCAGAGTT
CCCGCCGAGC ACAGGAAAAT CTGTTGTCCC ACTTAGTGCT GTCAACCCGA GTAGCTCTAT CCGTGTCACT GCAGGCATTA
TCCAACTCGG TGGTATCACT TTTACTGGTA GCACCGAGCA CCTGCAGAAG AATGGAGATT TCAATTTGCT CCTCTCTTTC
ACTGTCGAGG GCGACGTCTC AACCAAATCC ATTGGTTTTG AACCGGATAC GCAGATGAGC ACCACGCCAA TGGTGTTGCG
CAGCGGCATG TATCTTTTCT TCGTATCGGC GATGATTCTC ATGTTGAGCT ACAAAGTTGG GCTGTGTATC TACAGCAGGT
AAGTTATAGT AGTTTTTGTT GCCCCAGGCT GTTTATTAAA TTGAAGGAGT CATACAGAGT CCACTCGACG TAGAGGGAAC
TGCCTGCGAT TTGGACAGTT TGGTTCTTTA CATTGTTATA GTTGGTATAC CGTTCTGACA GTTGAAAGAT ACATAGCAAT
AAACTCTGGA ATTGGAGAAA CTAGAGTTAC ACGAATTTGG TGCTGAAACT TTTGTTGGTG GCATGTACTG TATAATTTAC
TCTATTTATT TATTTCACCC AATTCTGGGA GGCTGTAAGC GTTCCCCGAT CGATGTAAGC TGATCTGAAA CCTGAATACG
CGCTCTTCAT TTTTCATACC CAAAGGGCCG AGAGGCACAG TTTGCAGTT

Locus: Os02g0822400

Loading...

Locus: Os02g0822400

Loading...