Os02t0822900-01

Locus

Os02g0822900

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RLCK91

CGSNL Gene Name

RECEPTOR-LIKE CYTOPLASMIC KINASE 91

Oryzabase Gene Symbol Synonym(s)

OsPUB62, OsRLCK91

Oryzabase Gene Name Synonym(s)

plant U-box-containing protein 62, U-box protein 62, Receptor-like Cytoplasmic Kinase 91

Transcript Evidence

AK243658 (DDBJ, Best hit)

Protein Evidence

B9F4K1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Biological Process: protein ubiquitination (GO:0016567)

Cellular Component: ubiquitin ligase complex (GO:0000151)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ubiquitin-protein ligase activity (GO:0004842)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine-threonine/tyrosine-protein kinase (IPR001245)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

U box domain (IPR003613)

Protein kinase-like domain (IPR011009)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Rossmann-like alpha/beta/alpha sandwich fold (IPR014729)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

J100088O21 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0822900-01)

Others

Oryzabase (17853)

KEGG (Os02t0822900-01)

Transcript

3070 bp

>Os02t0822900-01 Hypothetical conserved gene.
AGCTTAGTAATAGTACCGCTTAAATCTGCATGCGTCTGTATATCAGCAGGCTCTCCATGG
CCATGGTCGATTCCTCCTAGCTTCCTTCATTCCTCAACGCTGCTGCTGCTGCTGCATGCG
TGCGTCGCCGTCTTGTCCTTTTTAATTCCAGAGTAGTTAGTTAGCAGCTAATCTTGGCTT
TAGTACTCCGTATTAGTTAGCCTAGCTTTGGATGAGCAGAAGGGCAGCGTGATCCTGTGC
ACAACCAAGAACCAACCCCAACACATGGAAGCTGCGGCAGGGGCAGGAGGAGCCATTGGA
GGTAGTGGTCGCGAGGCGGCGGCGGAGGAGGAGGACGGCGGCGAGCAGTGGCTAGAGGAG
GAGGCGGAGGCGGAGGCGGTGTACTGCGCCGTGGGGAAGGAGGCGGTGAAGGAATGGAAG
GCGAACCTCATGTGGGTGCTCGCCGCCTTCCCCTGGAGGAGGAGGAGGAGCCGCATCGTC
CTCATCCACGTCCACCGCCCGCCTTCCCGGGTCAATATGATGGGGGCATGGGTCCCAGTA
AGTCAGCTTGCAGAGGAGGAGGTGAATGCATACAGGCAGCTGGAGGAGGAGAGGATCAGC
AAAGTCTTAGATGATCTCTTGGACATTTGCAAAAGTCAAAAGGTCAATGCGAGCAAGATC
ATCTTCTCCTGCGACGACATCGCGAGAGGCCTCCTCCAGCTCGTCGATGATCATGGGATC
ACTGATCTTGTCATGGGAGCAGCATCTGACAAGGCCTATTCAAGGAAAATGCGGGCGCCG
AGATCTAAGAAAGCTCGGAAGGTGCAACTGAAGGCGAGCCCCTCTTGCAAGATCTGGTTT
GTCTGCAAAGGAAACCTTATCTGCACTAGGGAGGTGAACGAAGGACTCAATAGAACAGGA
TCATCGACAACTAGCACAACTCCGAGGTCGAGCACTTCTGATTACTCGAGGTCGAGATCC
TCGCCACGAGTGCACAGCCTAAGCAGCGAGCAATTCGGTATGCAGGATCCAGCCGAACCG
ACGACATCATCAGTTGATCAGACTCCTATCAGGGAGGACAATGCCATGGACCGTGGCACT
GAGGGTTTTAATCATGAAGCAGTTGCTGTTGCTAGTTCATCAACAGTCCCAGTGTCTGAA
AATGTAGAGGCTGTACAGAGATCAGCTGCTGCTGTTGTGCAGTCTCTGCAAGAAATTGAA
GAGGACTCACCAACTCCTTCAGGGCATGGTTCGGAGGATGCTGGTGATGTGAGCGATGCG
TACGACAAGTTCAAGGATGCTGTGATAGAAGCCGAGAACCTCAGGCATGAGGCATACGAG
GAGACTCGCCGGCGTCAAAAGGTCGAGCGCGACCTCGCCGACGCGACAAGAATTGCGAAC
GAAGCGGAGAGCTCGCAGCAGAGGGAGGCGAGGCATCGGAAGGAGGTGGAGGAGAGGCTG
GCGAGGGAGCGCGCGGCCATGGAGCAGGACAGGCGAGAGCTCGACGACATACTCGAGCAG
ACACGCGAGGTGGACGCCCGCGCCGCCGAGCTCGAGCTCCAGATCACGAGCTCCGAGCGG
ATGATGAGAGACCTCGAGGCCAAGCTGTCGGAATCGTACGACCTCCTCCACCAGCTCCGG
CGAGAGCGCCGGCGCGACGATGTGCCGGCGGAAGCAATGGCGGGAAGCGAGGCTGGTGAC
CAGAGACTGACCTTCTTGCGGCTCGGCTTGCCGGAGCTGGAGGAGGCGACCAACCATTTC
GACGAATCTGTCAGGATCGGAGGCGGCGACGGCAGCCGTGGCAGCGTGTACAGGGGCGAC
CTGCGCAGCATGGCGGTCGCCGTCAAGATGATCGGCCGTGACGTCGCCGTCGACGAGGTC
GGTTTCTGCCGCGAGGTGGAAGCCGTCGGCAGGGCGAGGCACCCGAACCTCGTCACGCTC
GTGGGCGCGTGCCCGGAGGCCCGCGCCGTGGTGCACGAGTTCGTGCCGGGCGGGAGCTTG
GAGGACCGCCTcgccggcgccgcgccggcgctgccgtggcacgagctgtgcggcgtggcg
caccgggcatgctccgcgctggcgttcctccactcgacgcagccacgggcgacggtgcac
ggcgacgtccggccggcgaacatcctcctgggcgAGGAGTGCTGCTCGAGCAAGCTTGCC
GGCCTCGGCATGTGCAGGCTGGTGCGGAGCTCCGGCGGCGTGGCGCTGTCAAGGCCGGCG
GTGGGCTACGTGGACCCGCGGCACCTGGCGACGGGGGAGATGACCCCGGAACGCGACGTG
TACGCGCTGGGCGtggtcctcctccggctcgtcaccgggaagccgccgttgatggcgaag
caggaggcgcgggaggccgcgggcggcagcaaggcgtggcacgaggtgttcgacgcgagc
tctggaggctggccgttggaggtcgccagggaggtggcgctcgtcgggctgaaatgctgc
gacgtggaggaggagccagcggGAGCTCGCCGTCCCGGCGAACTTCTGGAGGAGGCATGC
GGCGTGCTGGAGGCGGCGATGAGCGCGGCGCCGGGGAGGTCGTGGTCGTCGGTGTCGTCG
TCGTCGGACGGCGGTGAGGGCGGGGCGCCGTCCTACTTCGTGTGCCCGATCTTGAAGGAG
GTGATGCGGGACCCGCAGATCGCCGGAGACGGGTTCTCGTACGAGGCGGAGGCGATCAGG
GAGTGGCTGCGCAGCGGGCGCGACACGTCGCCGATGACGAACCTGAAGCTGCCCCGCCGC
GAGCTCGTCCCCAACCATCCCCTCCGCGACGCCATCCACCACTGGCGCCTCCGCCGCGCC
ATGCGAACCAACTTTACTACTGGATTAGATAGCTACTACTACTAGGCCCTTAGCACTTGT
AAGGCCCACGTTTTTAGTGGGTTTTTTTAAACTTTTTTACAGTCCACGGCCCGTATTTCC
GATTGTAACCCCCGGCATTTTCCATTTCGATCCATATTTTGGACCGTTCTCCCCCAGTAG
GCGTAATGGTCCAACATTTTTGCATCCAAGTCCCTAATTAATTAATTATTTCAGTGAAAA
ATTCAGAAAG

CDS

2601 bp

>Os02t0822900-01 Hypothetical conserved gene.
ATGGAAGCTGCGGCAGGGGCAGGAGGAGCCATTGGAGGTAGTGGTCGCGAGGCGGCGGCG
GAGGAGGAGGACGGCGGCGAGCAGTGGCTAGAGGAGGAGGCGGAGGCGGAGGCGGTGTAC
TGCGCCGTGGGGAAGGAGGCGGTGAAGGAATGGAAGGCGAACCTCATGTGGGTGCTCGCC
GCCTTCCCCTGGAGGAGGAGGAGGAGCCGCATCGTCCTCATCCACGTCCACCGCCCGCCT
TCCCGGGTCAATATGATGGGGGCATGGGTCCCAGTAAGTCAGCTTGCAGAGGAGGAGGTG
AATGCATACAGGCAGCTGGAGGAGGAGAGGATCAGCAAAGTCTTAGATGATCTCTTGGAC
ATTTGCAAAAGTCAAAAGGTCAATGCGAGCAAGATCATCTTCTCCTGCGACGACATCGCG
AGAGGCCTCCTCCAGCTCGTCGATGATCATGGGATCACTGATCTTGTCATGGGAGCAGCA
TCTGACAAGGCCTATTCAAGGAAAATGCGGGCGCCGAGATCTAAGAAAGCTCGGAAGGTG
CAACTGAAGGCGAGCCCCTCTTGCAAGATCTGGTTTGTCTGCAAAGGAAACCTTATCTGC
ACTAGGGAGGTGAACGAAGGACTCAATAGAACAGGATCATCGACAACTAGCACAACTCCG
AGGTCGAGCACTTCTGATTACTCGAGGTCGAGATCCTCGCCACGAGTGCACAGCCTAAGC
AGCGAGCAATTCGGTATGCAGGATCCAGCCGAACCGACGACATCATCAGTTGATCAGACT
CCTATCAGGGAGGACAATGCCATGGACCGTGGCACTGAGGGTTTTAATCATGAAGCAGTT
GCTGTTGCTAGTTCATCAACAGTCCCAGTGTCTGAAAATGTAGAGGCTGTACAGAGATCA
GCTGCTGCTGTTGTGCAGTCTCTGCAAGAAATTGAAGAGGACTCACCAACTCCTTCAGGG
CATGGTTCGGAGGATGCTGGTGATGTGAGCGATGCGTACGACAAGTTCAAGGATGCTGTG
ATAGAAGCCGAGAACCTCAGGCATGAGGCATACGAGGAGACTCGCCGGCGTCAAAAGGTC
GAGCGCGACCTCGCCGACGCGACAAGAATTGCGAACGAAGCGGAGAGCTCGCAGCAGAGG
GAGGCGAGGCATCGGAAGGAGGTGGAGGAGAGGCTGGCGAGGGAGCGCGCGGCCATGGAG
CAGGACAGGCGAGAGCTCGACGACATACTCGAGCAGACACGCGAGGTGGACGCCCGCGCC
GCCGAGCTCGAGCTCCAGATCACGAGCTCCGAGCGGATGATGAGAGACCTCGAGGCCAAG
CTGTCGGAATCGTACGACCTCCTCCACCAGCTCCGGCGAGAGCGCCGGCGCGACGATGTG
CCGGCGGAAGCAATGGCGGGAAGCGAGGCTGGTGACCAGAGACTGACCTTCTTGCGGCTC
GGCTTGCCGGAGCTGGAGGAGGCGACCAACCATTTCGACGAATCTGTCAGGATCGGAGGC
GGCGACGGCAGCCGTGGCAGCGTGTACAGGGGCGACCTGCGCAGCATGGCGGTCGCCGTC
AAGATGATCGGCCGTGACGTCGCCGTCGACGAGGTCGGTTTCTGCCGCGAGGTGGAAGCC
GTCGGCAGGGCGAGGCACCCGAACCTCGTCACGCTCGTGGGCGCGTGCCCGGAGGCCCGC
GCCGTGGTGCACGAGTTCGTGCCGGGCGGGAGCTTGGAGGACCGCCTcgccggcgccgcg
ccggcgctgccgtggcacgagctgtgcggcgtggcgcaccgggcatgctccgcgctggcg
ttcctccactcgacgcagccacgggcgacggtgcacggcgacgtccggccggcgaacatc
ctcctgggcgAGGAGTGCTGCTCGAGCAAGCTTGCCGGCCTCGGCATGTGCAGGCTGGTG
CGGAGCTCCGGCGGCGTGGCGCTGTCAAGGCCGGCGGTGGGCTACGTGGACCCGCGGCAC
CTGGCGACGGGGGAGATGACCCCGGAACGCGACGTGTACGCGCTGGGCGtggtcctcctc
cggctcgtcaccgggaagccgccgttgatggcgaagcaggaggcgcgggaggccgcgggc
ggcagcaaggcgtggcacgaggtgttcgacgcgagctctggaggctggccgttggaggtc
gccagggaggtggcgctcgtcgggctgaaatgctgcgacgtggaggaggagccagcggGA
GCTCGCCGTCCCGGCGAACTTCTGGAGGAGGCATGCGGCGTGCTGGAGGCGGCGATGAGC
GCGGCGCCGGGGAGGTCGTGGTCGTCGGTGTCGTCGTCGTCGGACGGCGGTGAGGGCGGG
GCGCCGTCCTACTTCGTGTGCCCGATCTTGAAGGAGGTGATGCGGGACCCGCAGATCGCC
GGAGACGGGTTCTCGTACGAGGCGGAGGCGATCAGGGAGTGGCTGCGCAGCGGGCGCGAC
ACGTCGCCGATGACGAACCTGAAGCTGCCCCGCCGCGAGCTCGTCCCCAACCATCCCCTC
CGCGACGCCATCCACCACTGGCGCCTCCGCCGCGCCATGCGAACCAACTTTACTACTGGA
TTAGATAGCTACTACTACTAG

Protein

867 aa

>Os02t0822900-01 Hypothetical conserved gene.
MEAAAGAGGAIGGSGREAAAEEEDGGEQWLEEEAEAEAVYCAVGKEAVKEWKANLMWVLA
AFPWRRRRSRIVLIHVHRPPSRVNMMGAWVPVSQLAEEEVNAYRQLEEERISKVLDDLLD
ICKSQKVNASKIIFSCDDIARGLLQLVDDHGITDLVMGAASDKAYSRKMRAPRSKKARKV
QLKASPSCKIWFVCKGNLICTREVNEGLNRTGSSTTSTTPRSSTSDYSRSRSSPRVHSLS
SEQFGMQDPAEPTTSSVDQTPIREDNAMDRGTEGFNHEAVAVASSSTVPVSENVEAVQRS
AAAVVQSLQEIEEDSPTPSGHGSEDAGDVSDAYDKFKDAVIEAENLRHEAYEETRRRQKV
ERDLADATRIANEAESSQQREARHRKEVEERLARERAAMEQDRRELDDILEQTREVDARA
AELELQITSSERMMRDLEAKLSESYDLLHQLRRERRRDDVPAEAMAGSEAGDQRLTFLRL
GLPELEEATNHFDESVRIGGGDGSRGSVYRGDLRSMAVAVKMIGRDVAVDEVGFCREVEA
VGRARHPNLVTLVGACPEARAVVHEFVPGGSLEDRLAGAAPALPWHELCGVAHRACSALA
FLHSTQPRATVHGDVRPANILLGEECCSSKLAGLGMCRLVRSSGGVALSRPAVGYVDPRH
LATGEMTPERDVYALGVVLLRLVTGKPPLMAKQEAREAAGGSKAWHEVFDASSGGWPLEV
AREVALVGLKCCDVEEEPAGARRPGELLEEACGVLEAAMSAAPGRSWSSVSSSSDGGEGG
APSYFVCPILKEVMRDPQIAGDGFSYEAEAIREWLRSGRDTSPMTNLKLPRRELVPNHPL
RDAIHHWRLRRAMRTNFTTGLDSYYY*

5'UTR

chr02:35334956..35335219 (+ strand) : 264 bp

CDS

chr02:35335220..35335475 (+ strand) : 256 bp

chr02:35336569..35336690 (+ strand) : 122 bp

chr02:35336868..35336989 (+ strand) : 122 bp

chr02:35337158..35337262 (+ strand) : 105 bp

chr02:35337909..35338272 (+ strand) : 364 bp

chr02:35338688..35338828 (+ strand) : 141 bp

chr02:35339126..35340616 (+ strand) : 1491 bp

3'UTR

chr02:35340617..35340821 (+ strand) : 205 bp

FASTA

>Os02t0822900-01 class=Sequence position=chr02:35334956..35340821 (+ strand)
AGCTTAGTAA TAGTACCGCT TAAATCTGCA TGCGTCTGTA TATCAGCAGG CTCTCCATGG CCATGGTCGA TTCCTCCTAG
CTTCCTTCAT TCCTCAACGC TGCTGCTGCT GCTGCATGCG TGCGTCGCCG TCTTGTCCTT TTTAATTCCA GAGTAGTTAG
TTAGCAGCTA ATCTTGGCTT TAGTACTCCG TATTAGTTAG CCTAGCTTTG GATGAGCAGA AGGGCAGCGT GATCCTGTGC
ACAACCAAGA ACCAACCCCA ACACATGGAA GCTGCGGCAG GGGCAGGAGG AGCCATTGGA GGTAGTGGTC GCGAGGCGGC
GGCGGAGGAG GAGGACGGCG GCGAGCAGTG GCTAGAGGAG GAGGCGGAGG CGGAGGCGGT GTACTGCGCC GTGGGGAAGG
AGGCGGTGAA GGAATGGAAG GCGAACCTCA TGTGGGTGCT CGCCGCCTTC CCCTGGAGGA GGAGGAGGAG CCGCATCGTC
CTCATCCACG TCCACCGCCC GCCTTCCCGG GTCAATATGA GTATGCTCCA TCGCTAGCTA TTTCATTCCA AATACTATTC
CAGTTTATTT CCAATTAACT CCCGTTCTTC ATTGCGTGCG TTCTTCTTGT TGCAGTTCGC TAATTCTTGC GGTCTTCTTG
TTGTTTGCAG AGGTTTTGGT TGTTTATGCT TCTTATTGTT TTTTTTTTCT GTTTAATTTT ACGGGTTCTC AATTGCCCCC
ATGCATCTGT TCTTGCTTGT AATTAATCCG GTTCAGAAAT GGCTTTTTTT TTCTGTTTCT TGGCATTTGA TTGCACTCCT
TCGAAATGGC ACCATTGCAA TCTCAGTATT CCAACCATTG CAAACTTTTT ATATATATAA AATTCATCTC CCGTTATCGG
CAAATACCTG ATCTTTTCAA ATCCGCTCTT GCAAATAACA GAAAATAATT CAAACCACCT TCCCTAAATG CGACAAATCT
AATTTTTCTA GAAAGATCAT TCCATTTCTT TTTGGCAAAT AACAACCCAT TTCAAGCTAG CTGCTGTCTC CTCCATGGAA
ACTGGGGTTT TTTGATGCTG CGGCTGTTCT ACGTGCACTG CTTACATTCC TTTTATTTTC CCATTTGAGG CCTCAATTTG
TTTTCTGACT TGTCGTGGAC GTGCATTATC AAGGAAAAAA AATGCGTAGA AATCAACATC TCGGACAACT TAAACTATTG
CTCAGAATAA TCTTATACAA ATACATCTCT GCCAAGTGGA ACAGTACTAT AGTTTCTGCT AAGCATATCC GTCTTCAGCT
AAAAGCATAT TCACTGTTTG TATTTTCAGT CTAATTAAGA ATTGCAATGC TAGCTCTGAC CTTAATCAGG TTGTAAAACA
TTTCCCCTTT TATCTGGCTA TTATTTTGAT GAAATCAAAA TGTTAGACTT GGCTACCAAT ATTTTCTTGT AAAATGACAC
CAGCTGGCTG TTTATGTTCT CTTTGCTTTT CCCACCAAAT CTGTCAACCT GAAAGTAGGT GCCTTTTGTT ATGTTCCTAC
CTTTACAATA CCTTTTACAT TACACTTTTG TGTTCCAAAA AATGTTGGAT CTTTTGTGAC ATTTTTTTTT GGGTACTACC
TGTGGATTTG CAGTGGGGGC ATGGGTCCCA GTAAGTCAGC TTGCAGAGGA GGAGGTGAAT GCATACAGGC AGCTGGAGGA
GGAGAGGATC AGCAAAGTCT TAGATGATCT CTTGGACATT TGCAAAAGTC AAAAGGTTGA AACCATGATA AAGAGTTCAT
TGTTTTACAT TTGATCCATC TTGCTTGCTG TCAATATCAG ATTGCTAGTC TCAACTCACC AGCAGCCTCT GGCTGTGTTC
TTATTATGAC AGTCTCCCTC TTCTCCATAT GCAGCCTGGG TTGCTAACAA AGTTGCTGAA AAAAACTCGC AGGTCAATGC
GAGCAAGATC ATCTTCTCCT GCGACGACAT CGCGAGAGGC CTCCTCCAGC TCGTCGATGA TCATGGGATC ACTGATCTTG
TCATGGGAGC AGCATCTGAC AAGGCCTATT CAAGGTATGG CTGTCTTGTT CTTGGAAATT AATACATACA AATCCAGCTC
TCGCTGTCGC TGCTGTTGTT ATCAATCGAT CGGTCCAAGA ACTGGCTGGT CCAGCTTGGT GCCAGTGGAT TGCTGAATTC
AAAGGCAAAT GATCTGGAAT TCTGGATGCA ATGTGATGTT AGGAAAATGC GGGCGCCGAG ATCTAAGAAA GCTCGGAAGG
TGCAACTGAA GGCGAGCCCC TCTTGCAAGA TCTGGTTTGT CTGCAAAGGA AACCTTATCT GCACTAGGTA TGCATGCATG
ACTCAAAAAA GTCTTAATGC CAACGATGCA ACTTGCAAAA GCCTTTGGTT TTTCTTCTCC CTGTCTTGCT CAAAATGGGA
CAGGTATTTG TAGATTTCTA TGATAGCACT GATGACAAAG ACTGAAGACT GAATTGAAGT AGCACACCGT TTAACTCGTG
GTTATTCTTC TATCATTGTA AGGAACATGA TAGAAACTTT TTTTTTCTCG AGATAAACAT GATAGAAACT GTGGTTGCGT
CGGCAACATT TCCCGACATA GTTGTCTGGG AATTTACCGT TCTTCTATGA CCATTTTAGC TGTTCTCACA TTAAGACAAT
GATCACAGAC TGAATTAGGC CAGACATCCT GCTCAAAAAA GAATTAGGCC AGACAAAGAA TAATCTGATA TACTGATAAT
ATGATAATGT TTATGACAAA TGACTAACAA AATAACAAAC CTTGAACAAA AATAGTACCT GTGGAAGCAC TGAGATTGCC
TGAACATCCT AGTTTGTGAC ATATTATTCT GAACTTTTGG CATTCTTCTA TTAGCTTTCT AGCTGTTCTA ACATAAGGAT
ATTCTATTTT TCCTGGAAAA ATATTATAAG ATTTACATAT TTCCTTTAAT TCCATTTGTC TGATCCGTTA TAGGGAGGTG
AACGAAGGAC TCAATAGAAC AGGATCATCG ACAACTAGCA CAACTCCGAG GTCGAGCACT TCTGATTACT CGAGGTCGAG
ATCCTCGCCA CGAGTGCACA GCCTAAGCAG CGAGCAATTC GGTATGCAGG ATCCAGCCGA ACCGACGACA TCATCAGTTG
ATCAGACTCC TATCAGGGAG GACAATGCCA TGGACCGTGG CACTGAGGGT TTTAATCATG AAGCAGTTGC TGTTGCTAGT
TCATCAACAG TCCCAGTGTC TGAAAATGTA GAGGCTGTAC AGAGATCAGC TGCTGCTGTT GTGCAGTCTC TGCAAGAAAT
TGAAGAGGAC TCACCAACTC CTTCAGGGCA TGGTTCGGTA TGTGCTATAC GTTTCATAAA TCATACAGTA TAATACTAGT
TTCAAGGGAA AAAAAGTTGA AAGAATTTTT AAAGAAAAAA TGAACAAATC CCAACATGTA GAAAAAAACT ATCTGAATTC
CACATTACAT GACATCTGTT TACTTGTTCA GTTACATCAA GTGCTAGACA TCTGTTTATT TTCCTACTCC TAGATTGTTT
GATCTTGGAC TGCTGAAAAT GGTACTAAAA TTGTCGAAAT GACTTGTTTT TGTCTCCACT ACAGAAACAT AATTTGAACA
GCACATGTTT CATAAGTCGA AGATTTTGGC CAACTGATCT GCACCAGAAT ATACAGCATC AGTGTAATAC ACATTATATG
TGTTTCAGAT AGTAAACATT TAAACAATAA ACGGTGCATT CCGTTTTGAC AGGAGGATGC TGGTGATGTG AGCGATGCGT
ACGACAAGTT CAAGGATGCT GTGATAGAAG CCGAGAACCT CAGGCATGAG GCATACGAGG AGACTCGCCG GCGTCAAAAG
GTCGAGCGCG ACCTCGCCGA CGCGACAAGA ATTGTAAGTA GAGGAAATGA ATCCAAGCTG CATTGCATCG TTGGTTCGAT
CCCATTGTTC ATGTCGAATT CACCATGGAT GCTTCCCGCT GATTGAAGTT GCGTTTACTC GTCGtagtag tctcttcctt
tttcttcttt agtttttctt gttttgtctt ttctctcttc tcttggcata agccggtctg gcggattacg ttgtataaac
aaacattctt ttcttctgat atattgacgt gcaattcttt tacgtgttcg tgaaaaAATT CACCATGGAT GGATGATGTG
ATCGATGCAG GCGAACGAAG CGGAGAGCTC GCAGCAGAGG GAGGCGAGGC ATCGGAAGGA GGTGGAGGAG AGGCTGGCGA
GGGAGCGCGC GGCCATGGAG CAGGACAGGC GAGAGCTCGA CGACATACTC GAGCAGACAC GCGAGGTGGA CGCCCGCGCC
GCCGAGCTCG AGCTCCAGAT CACGAGCTCC GAGCGGATGA TGAGAGACCT CGAGGCCAAG CTGTCGGAAT CGTACGACCT
CCTCCACCAG CTCCGGCGAG AGCGCCGGCG CGACGATGTG CCGGCGGAAG CAATGGCGGG AAGCGAGGCT GGTGACCAGA
GACTGACCTT CTTGCGGCTC GGCTTGCCGG AGCTGGAGGA GGCGACCAAC CATTTCGACG AATCTGTCAG GATCGGAGGC
GGCGACGGCA GCCGTGGCAG CGTGTACAGG GGCGACCTGC GCAGCATGGC GGTCGCCGTC AAGATGATCG GCCGTGACGT
CGCCGTCGAC GAGGTCGGTT TCTGCCGCGA GGTGGAAGCC GTCGGCAGGG CGAGGCACCC GAACCTCGTC ACGCTCGTGG
GCGCGTGCCC GGAGGCCCGC GCCGTGGTGC ACGAGTTCGT GCCGGGCGGG AGCTTGGAGG ACCGCCTcgc cggcgccgcg
ccggcgctgc cgtggcacga gctgtgcggc gtggcgcacc gggcatgctc cgcgctggcg ttcctccact cgacgcagcc
acgggcgacg gtgcacggcg acgtccggcc ggcgaacatc ctcctgggcg AGGAGTGCTG CTCGAGCAAG CTTGCCGGCC
TCGGCATGTG CAGGCTGGTG CGGAGCTCCG GCGGCGTGGC GCTGTCAAGG CCGGCGGTGG GCTACGTGGA CCCGCGGCAC
CTGGCGACGG GGGAGATGAC CCCGGAACGC GACGTGTACG CGCTGGGCGt ggtcctcctc cggctcgtca ccgggaagcc
gccgttgatg gcgaagcagg aggcgcggga ggccgcgggc ggcagcaagg cgtggcacga ggtgttcgac gcgagctctg
gaggctggcc gttggaggtc gccagggagg tggcgctcgt cgggctgaaa tgctgcgacg tggaggagga gccagcggGA
GCTCGCCGTC CCGGCGAACT TCTGGAGGAG GCATGCGGCG TGCTGGAGGC GGCGATGAGC GCGGCGCCGG GGAGGTCGTG
GTCGTCGGTG TCGTCGTCGT CGGACGGCGG TGAGGGCGGG GCGCCGTCCT ACTTCGTGTG CCCGATCTTG AAGGAGGTGA
TGCGGGACCC GCAGATCGCC GGAGACGGGT TCTCGTACGA GGCGGAGGCG ATCAGGGAGT GGCTGCGCAG CGGGCGCGAC
ACGTCGCCGA TGACGAACCT GAAGCTGCCC CGCCGCGAGC TCGTCCCCAA CCATCCCCTC CGCGACGCCA TCCACCACTG
GCGCCTCCGC CGCGCCATGC GAACCAACTT TACTACTGGA TTAGATAGCT ACTACTACTA GGCCCTTAGC ACTTGTAAGG
CCCACGTTTT TAGTGGGTTT TTTTAAACTT TTTTACAGTC CACGGCCCGT ATTTCCGATT GTAACCCCCG GCATTTTCCA
TTTCGATCCA TATTTTGGAC CGTTCTCCCC CAGTAGGCGT AATGGTCCAA CATTTTTGCA TCCAAGTCCC TAATTAATTA
ATTATTTCAG TGAAAAATTC AGAAAG

Locus: Os02g0822900

Loading...

Locus: Os02g0822900

Loading...