Os02t0826600-01

Locus

Os02g0826600

Description

Leucine-rich repeat, typical subtype containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIRL6

Oryzabase Gene Name Synonym(s)

intracellular Ras-group-related LRR protein 6

Transcript Evidence

AK073434 (DDBJ, Best hit)

Protein Evidence

B9F4M3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Leucine-rich repeat (IPR001611)

Leucine-rich repeat, typical subtype (IPR003591)

Full-length cDNA

J033042L19 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0826600-01)

RiceXPro (AK073434)

Others

Oryzabase (17577)

KEGG (Os02t0826600-01)

Transcript

2218 bp

>Os02t0826600-01 Leucine-rich repeat, typical subtype containing protein.
GATCTCTCTTCTAGTCTTCTTCGTGGGTAGGCTCGTGCTGCCTCTGCCTGCTGGTGCAGC
AGATCAGATCAGGTCTCCGGCGATGGCGATCTGAGGCCGGAGGCTGCTTGCTTCTGCTTG
CATGGAGCGGGTGCTCAAATCCGCCAGGGAGTCGGGCTCCCTCAACCTCTCCAATCGATC
CCTCAGGGAGGTACCCAAGGAGGTGTACAACAACTTGGACACGGGGGCTCAGGATGAGAA
ATGGTGGGAGGGAGTTGACCTTCAGAAGCTCATATTGGCTCATAACAACCTTGAGGTGTT
GCGTGAAGACCTCAGAAATTTGTCTTCGCTCGTTGTATTAAACATTAGTCACAACAATAT
TTCTTCCCTCCCCGCAGCTATTGGAGACCTTCCTTTGCTAAAATCGTTGGATGTATCTTC
TAATCAAATAAACGCTTTTCCCGAAGAGATTGGTTTTGCGACCGCTTTAGTCAAGGTTGA
CTGCTCAAATAATTGCCTTACAGATCTCCCAGTTAGTCTTGCCAGATGCCTGGAGTTGTC
AGAACTCAATGCGTCAAACAACACTATATCCGTACTGCCAGATGAACTTGCTGGCTGTTC
CAAGTTATTCAGATTGAATCTAGAGGGTAACAAGCTCGTGACGCTATCAGACAAGATGTT
TATGTCATGGACAATGCTTACAGAGATGAATGCTGCAAAGAATCTACTGACAGCCATCCC
GGATGGTATTGGTGCACTGTCAAAGCTAATTCGTCTGGACCTGCATCAGAACAAAATAAC
CCTGATTCCTCCTTCCATAAAAGATTGCTCTTCTCTAGCAGAGTTTTATATGGGAAATAA
CTTGTTGACATCCATACCAGAGGATATTGGCATGCTATCGAACTTGGGAATACTTGATCT
ACACTCTAACCAGCTAAAGGAGTATCCTGTCGGGGCTTGTAGACTCAAGCTCTCTTTCCT
TGATCTATCAAACAACTCATTATCTGGTCTGCCTGCTGAACTAGGTACTATGACAACCCT
AAGAAAGCTTCTGCTTACTGGTAATCCTATGAGGACACTTCGGAGTTCCTTGGTTTCTGG
ACCAACAACAGCATTATTAAAGTATCTGCGCAGTCGGCTTTCATCTGATGAAGGAGCATC
AGGATCTGGAAGCACTCCAACAAAAGATGATCAAATTGCTGCAGCAAGAAGATTGTCTTT
ATCTTCTAAGGAACTGGACTTGAGTGGTCTTGGTGTGACCAGTGTACCACCTGCAGCTTG
GGAGACAAATGATGTGATGAAACTAGATCTTTCTAAGAATTCAATAGAAGATCTGCCAAA
CGAGTTGTCATTATGCTCGTCACTTCAATCTTTGATTTTGTCTAACAACAAAATTAAAAG
GTGGCCTGGCACCGTATTCTCCTCCCTTGCCAGCCTTTCTTTGTTAAAGCTAGACAACAA
TCCTTTGGCAGAGATATTGGCTACTGATCTTGAGGCCCTGTCTAAACTTGAAGTACTAGA
TTTAAGTGGCAGTGCTTCTTCTCTACCTGAACCCTCTGCGGTTTCGAAATTACCTCACCT
AAAGGAACTCTACCTAAGACGAATGAAACTCCATGGATTTCCTGATAGTTTATTGGGCTT
AAAACTGCTGCGAATTCTTGATCTGAGTCAGAATTATCTTACATCTGTGCCAGAGGGTAT
CAAAGATTTAACTTCTTTGATTGAGCTTGATCTGTCGGACAACAATATAACAACACTCCC
ACCTGAGCTGGGTTTGCTTGAGCCTAACCTGCAAGTCTTGAAACTTGATGGAAATCCCCT
CAGGAGCATACGGCGGACTCTGCTGGAGCGAGGAACGAAAGCAATTCTGAAGTATCTCAA
AGAAAAGCTACCTGCTGAATAAATTCTGGTGGGAATTAATGTATGCTGCATGATGTTTAT
TGATCAGTTCGGCCCTCTCGAACTGCAGTTACCTTTTCCTGGAGTCCATTTATCCCCaaa
ttgttttttccttgattgatgtaatttttgcttggctatcttcttggtgatcgttatcat
tCTCCTCATTTTATCCGCGGATTGCTGTCACACTGAAAGCTTCTCAGCTTGTGTATAACC
AACCTTGTATGCAGTATACAGCAGATCAGAATTCGGTTATGTTGTAGTATTTTGACACTG
GAAGTCCCGCACGTGTGAAAAAAAATCTGCCGCCACAAGTGAAACTTTGTTTCTTGCC

CDS

1761 bp

>Os02t0826600-01 Leucine-rich repeat, typical subtype containing protein.
ATGGAGCGGGTGCTCAAATCCGCCAGGGAGTCGGGCTCCCTCAACCTCTCCAATCGATCC
CTCAGGGAGGTACCCAAGGAGGTGTACAACAACTTGGACACGGGGGCTCAGGATGAGAAA
TGGTGGGAGGGAGTTGACCTTCAGAAGCTCATATTGGCTCATAACAACCTTGAGGTGTTG
CGTGAAGACCTCAGAAATTTGTCTTCGCTCGTTGTATTAAACATTAGTCACAACAATATT
TCTTCCCTCCCCGCAGCTATTGGAGACCTTCCTTTGCTAAAATCGTTGGATGTATCTTCT
AATCAAATAAACGCTTTTCCCGAAGAGATTGGTTTTGCGACCGCTTTAGTCAAGGTTGAC
TGCTCAAATAATTGCCTTACAGATCTCCCAGTTAGTCTTGCCAGATGCCTGGAGTTGTCA
GAACTCAATGCGTCAAACAACACTATATCCGTACTGCCAGATGAACTTGCTGGCTGTTCC
AAGTTATTCAGATTGAATCTAGAGGGTAACAAGCTCGTGACGCTATCAGACAAGATGTTT
ATGTCATGGACAATGCTTACAGAGATGAATGCTGCAAAGAATCTACTGACAGCCATCCCG
GATGGTATTGGTGCACTGTCAAAGCTAATTCGTCTGGACCTGCATCAGAACAAAATAACC
CTGATTCCTCCTTCCATAAAAGATTGCTCTTCTCTAGCAGAGTTTTATATGGGAAATAAC
TTGTTGACATCCATACCAGAGGATATTGGCATGCTATCGAACTTGGGAATACTTGATCTA
CACTCTAACCAGCTAAAGGAGTATCCTGTCGGGGCTTGTAGACTCAAGCTCTCTTTCCTT
GATCTATCAAACAACTCATTATCTGGTCTGCCTGCTGAACTAGGTACTATGACAACCCTA
AGAAAGCTTCTGCTTACTGGTAATCCTATGAGGACACTTCGGAGTTCCTTGGTTTCTGGA
CCAACAACAGCATTATTAAAGTATCTGCGCAGTCGGCTTTCATCTGATGAAGGAGCATCA
GGATCTGGAAGCACTCCAACAAAAGATGATCAAATTGCTGCAGCAAGAAGATTGTCTTTA
TCTTCTAAGGAACTGGACTTGAGTGGTCTTGGTGTGACCAGTGTACCACCTGCAGCTTGG
GAGACAAATGATGTGATGAAACTAGATCTTTCTAAGAATTCAATAGAAGATCTGCCAAAC
GAGTTGTCATTATGCTCGTCACTTCAATCTTTGATTTTGTCTAACAACAAAATTAAAAGG
TGGCCTGGCACCGTATTCTCCTCCCTTGCCAGCCTTTCTTTGTTAAAGCTAGACAACAAT
CCTTTGGCAGAGATATTGGCTACTGATCTTGAGGCCCTGTCTAAACTTGAAGTACTAGAT
TTAAGTGGCAGTGCTTCTTCTCTACCTGAACCCTCTGCGGTTTCGAAATTACCTCACCTA
AAGGAACTCTACCTAAGACGAATGAAACTCCATGGATTTCCTGATAGTTTATTGGGCTTA
AAACTGCTGCGAATTCTTGATCTGAGTCAGAATTATCTTACATCTGTGCCAGAGGGTATC
AAAGATTTAACTTCTTTGATTGAGCTTGATCTGTCGGACAACAATATAACAACACTCCCA
CCTGAGCTGGGTTTGCTTGAGCCTAACCTGCAAGTCTTGAAACTTGATGGAAATCCCCTC
AGGAGCATACGGCGGACTCTGCTGGAGCGAGGAACGAAAGCAATTCTGAAGTATCTCAAA
GAAAAGCTACCTGCTGAATAA

Protein

587 aa

>Os02t0826600-01 Leucine-rich repeat, typical subtype containing protein.
MERVLKSARESGSLNLSNRSLREVPKEVYNNLDTGAQDEKWWEGVDLQKLILAHNNLEVL
REDLRNLSSLVVLNISHNNISSLPAAIGDLPLLKSLDVSSNQINAFPEEIGFATALVKVD
CSNNCLTDLPVSLARCLELSELNASNNTISVLPDELAGCSKLFRLNLEGNKLVTLSDKMF
MSWTMLTEMNAAKNLLTAIPDGIGALSKLIRLDLHQNKITLIPPSIKDCSSLAEFYMGNN
LLTSIPEDIGMLSNLGILDLHSNQLKEYPVGACRLKLSFLDLSNNSLSGLPAELGTMTTL
RKLLLTGNPMRTLRSSLVSGPTTALLKYLRSRLSSDEGASGSGSTPTKDDQIAAARRLSL
SSKELDLSGLGVTSVPPAAWETNDVMKLDLSKNSIEDLPNELSLCSSLQSLILSNNKIKR
WPGTVFSSLASLSLLKLDNNPLAEILATDLEALSKLEVLDLSGSASSLPEPSAVSKLPHL
KELYLRRMKLHGFPDSLLGLKLLRILDLSQNYLTSVPEGIKDLTSLIELDLSDNNITTLP
PELGLLEPNLQVLKLDGNPLRSIRRTLLERGTKAILKYLKEKLPAE*

5'UTR

chr02:35532923..35533043 (- strand) : 121 bp

CDS

chr02:35532858..35532922 (- strand) : 65 bp

chr02:35532507..35532570 (- strand) : 64 bp

chr02:35532251..35532387 (- strand) : 137 bp

chr02:35531910..35531996 (- strand) : 87 bp

chr02:35531626..35531701 (- strand) : 76 bp

chr02:35531420..35531494 (- strand) : 75 bp

chr02:35531252..35531321 (- strand) : 70 bp

chr02:35531083..35531160 (- strand) : 78 bp

chr02:35530938..35530998 (- strand) : 61 bp

chr02:35530771..35530849 (- strand) : 79 bp

chr02:35529989..35530079 (- strand) : 91 bp

chr02:35529675..35529735 (- strand) : 61 bp

chr02:35529502..35529572 (- strand) : 71 bp

chr02:35529265..35529338 (- strand) : 74 bp

chr02:35528802..35528939 (- strand) : 138 bp

chr02:35528570..35528674 (- strand) : 105 bp

chr02:35527929..35528053 (- strand) : 125 bp

chr02:35527756..35527852 (- strand) : 97 bp

chr02:35527535..35527609 (- strand) : 75 bp

chr02:35527352..35527407 (- strand) : 56 bp

chr02:35526968..35527043 (- strand) : 76 bp

3'UTR

chr02:35526632..35526967 (- strand) : 336 bp

FASTA

>Os02t0826600-01 class=Sequence position=chr02:35526632..35533043 (- strand)
GATCTCTCTT CTAGTCTTCT TCGTGGGTAG GCTCGTGCTG CCTCTGCCTG CTGGTGCAGC AGATCAGATC AGGTCTCCGG
CGATGGCGAT CTGAGGCCGG AGGCTGCTTG CTTCTGCTTG CATGGAGCGG GTGCTCAAAT CCGCCAGGGA GTCGGGCTCC
CTCAACCTCT CCAATCGATC CCTCAGGTGC ATTGTCTCTC TCTGCTCGCT CGGTTGGATC GCCATCGGCG ACATGGACGA
TGATCTCTCC TAGTCTGTAG CCGCCGCCCA CTGCTCGGAC GCGACGCAAT CCAATCCCTT CCCGCCATGA CGCCTTCACC
TGCTTCTCAC ATCAGTTTAC TGCATTGCAT TGTCTGATTA TGGCCGGTGT ACTAGGGGAC CATGGGTTAA TCGATTCCAG
CGCGCGCGCA CACAGCTTCG CTCTTCTTGT TCTTGATGTC TCGCTGACGC CACACCTCTG CCTGTTCTGC CAGGGAGGTA
CCCAAGGAGG TGTACAACAA CTTGGACACG GGGGCTCAGG ATGAGAAATG GTGGGAGGTA AATCGATTCG CCCCCTTCCT
GTATGACTAT TTCCCTACAT GCTGCATAAA CAAGGGATAT CAAGCAACGC CAATCAAATT TGTTTCTGTT TCTGTTTTTT
TCCTTTTGTA ATTCAGGGAG TTGACCTTCA GAAGCTCATA TTGGCTCATA ACAACCTTGA GGTGTTGCGT GAAGACCTCA
GAAATTTGTC TTCGCTCGTT GTATTAAACA TTAGTCACAA CAATATTTCT TCCCTCCCCG CAGCTATTGG AGAGTATGTA
CTGGACTATC CTTATTTACT ACTCCCTCCG GTCATGGAAA CATATCGTTT GTGGACATGT TTGAAGTCAC TGCCTTCAAA
ACCAGTTTCA TAATATTATC ATTCTATCAA GATTTTCAAC TGTTTTTCGA TAGAGATTAC TGGTCAAGTT TGCAGGCATG
GTTTTTGTGA CAGGAGGGAG TAATTTCCAT TGTTAACCGT GGACCACTAA TATCATCTGA ACTTTTTTAT GGCTCTTTTC
CATGCAGCCT TCCTTTGCTA AAATCGTTGG ATGTATCTTC TAATCAAATA AACGCTTTTC CCGAAGAGAT TGGTTTTGCG
ACCGCTTTAG TCAAGTATGT CTTCTATGTC CCTTTTCTAA TTGATTTCAT TAATGTACTG TTAAAACAAG CTCAAAATTT
GGCTATTCAT ATTTCTAAAA CCATCTGTCA CATATTTTAG ATGTTATGAT GTTGACAATT AGTATGACGC CTAAATACAA
GAAGCAATGT TTGAGACTAT GTATGATTAT ATTCATGTAA GTTGATGCAT TGTTGTTGCC AGGGTTGACT GCTCAAATAA
TTGCCTTACA GATCTCCCAG TTAGTCTTGC CAGATGCCTG GAGTTGTCAG AACTCAATGT AAGCCACCAT CGATGTATTC
CTTATTTTCT CCATAAGGTT TCTTTGTTTG ATGAAGATAT ATACAGCTCA TCTTTATAGC TTCCCTCTTC ATCCTCTGTC
CTAAATATAA TGTAATGCCC TACCTGTAGG CGTCAAACAA CACTATATCC GTACTGCCAG ATGAACTTGC TGGCTGTTCC
AAGTTATTCA GATTGAATCT AGAGGTATAT ACTCCTTATA GAGAATGTCA AAGCTGGATT TATCATATTT TCGTGCTGCA
TTTCTTTTGT TCTTGAAAAC TCCAATTACT GCAAAATGTC AGGGTAACAA GCTCGTGACG CTATCAGACA AGATGTTTAT
GTCATGGACA ATGCTTACAG AGATGAATGC TGGTATGCCA CACAGCCACA GTACCAAAAA TAATGTCGAA CCTATGTGAT
ATCCTTGAGT TTCTACCTGA GATTAACATT CAAACCTGTA CAGCAAAGAA TCTACTGACA GCCATCCCGG ATGGTATTGG
TGCACTGTCA AAGCTAATTC GTCTGGACCT GCATCAGAAC AGTTAGTCTA CCATACTATC GCATATGCTA GCTCTTTATT
ATTCATTTTT ATCTGTATTG ATGGCTTTCT ACTTTTGTTA TGTAGAAATA ACCCTGATTC CTCCTTCCAT AAAAGATTGC
TCTTCTCTAG CAGAGTTTTA TATGGGGTTG GTTATCTATT TTGGACAAAC TTCTTTACCA TGCTCTTATT TTTAAACAGC
ACAAGTTCAC TCTATTTGTA CTTTTATGTT CCAGAAATAA CTTGTTGACA TCCATACCAG AGGATATTGG CATGCTATCG
AACTTGGGAA TACTTGATCT ACACTCTAAC CAGGTCTTAC TCCATTTATT TTCACAGATA CTGCCAATTT AATAGTCTAT
TATTCCCCTG ACTCTTGTTA TTCTGCACCA TTTTAAAATC TGAAGATACT GGGAGAAAGG CTCTTGATTT GATTTCTTTG
TTGCTGGGAC ATCAAATCTG TAGCTGTGTG GCTCAAAATT TTAGTACATC ATTTGTTTAT TCTAACATGA GGCTTTTTTG
CTTATGACTA TCTTGGGATG GTTTTTGAGA AAAAAGGATC ATCTCGGGAT GGCTAGGATA CACTCCAGTC CAGAAAATTT
CATGAATGTT TCGCTCCCTT AACATTTTCC CACTTCCCAA ATCCCAAGAG CTTCATTAAT AGTGTATGTA AACTGCATGT
GATTTACCAT AGTCACTCCC ACCATCTATA GGCTTGTCTA ATCCTGTCTG TTTTGTTAGA GGGATGGCGC TATGATATAT
TTTGAGTTCT TATTAACTCA GTTACTTACA TGTTCGGAAG GAATGGTGGA ACAGTGTTGT TCAGAATATT TGATGTAAAT
ATTGATCCCC AAAACCACTT TATTAGACAA CAACAAACTT CTCATGTTGT AACATTGAGC TTAACTTCTG CAACCAATCC
TGCTAGAATT AACAGAACAT TACAGAAGAA ATAAGTTCAT TTCTGTTTTT TTTATTATTT TCTGATAATA TGTCACTTTT
CCAGCTAAAG GAGTATCCTG TCGGGGCTTG TAGACTCAAG CTCTCTTTCC TTGATCTATC AAACAACTCA TTATCTGGTC
TGCCTGCTGA ACTAGGTTGG TTTTTCTGCT GTGCAATGCT CCTCTCGATG ATGCCACTTT TGTTATTTTC CTATTTGGTT
AGCTGAAATT TTATGATATG AAATGATTGC ATGCATCTCT ATGTGTTGGA TAGATCATAG GGCTGATTCT TTTTTTCCAT
GGGGTATCTG CTTTGAAAAC TTAGCATGCT CTATGCAAGT GTGCTACTAT CTTAATGAAC TTTCGAAACT ATGGACACTC
ACATATGCTT CGGCATGCTA TATTCAAGGT ACTATGACAA CCCTAAGAAA GCTTCTGCTT ACTGGTAATC CTATGAGGAC
ACTTCGGAGG TATGATGCCC ATGCCATTGT CCTAGTTTTT CACAAAGAGG TTGTCAGGAT TCTAAACAGA ACTGCCAACA
TAATAATACA GTGTTCCATT TTGGTTACCA GTTCCTTGGT TTCTGGACCA ACAACAGCAT TATTAAAGTA TCTGCGCAGT
CGGCTTTCAT CTGATGAAGG AGGTAACCAA AAACACAAAA TCAATATCCA TGCATTTTAT TGTTCATAAT GATGTATTTG
TAGTGCACAT TATCTGCTTC AAGCTTTGCC ACGTCTCCTG TTTTTTTTCT GATTTGAGAA CCATTATCCA TGATCACTCG
AAAGCTCAAC ATATTTCCTG TGCAGCATCA GGATCTGGAA GCACTCCAAC AAAAGATGAT CAAATTGCTG CAGCAAGAAG
ATTGTCTTTA TCTTCTAAGG TACTTTAATT ATTTCGACAG CATATTTGTA TATCATAAGA TAGATCTCTT TTTATGTCTT
TTTTAAAAGG AGCTAATTCA CCCACATGTG GTATTTGCCA TTCATGGATT GTCTCATTCA TGCCAAAAGA GTAACTGATT
TGTGTGTTTC TATCTGCCAT GTTTCCTGTA TTTTTACAAA AACTTGTCGA CTTTTTCAAT GTATTCTCAT GACTACCAAT
GCAAGAATAA AATATCTTGG TCATTGGATC TTATGGAGCC TCATGGAATA ACCAATGATC GTTTCATTTT TTCCACAATA
GCCCCTAACT TGGTGCAATA TCAGGAACTG GACTTGAGTG GTCTTGGTGT GACCAGTGTA CCACCTGCAG CTTGGGAGAC
AAATGATGTG ATGAAACTAG ATCTTTCTAA GAATTCAATA GAAGATCTGC CAAACGAGTT GTCATTATGC TCGTCACTTC
AAGTGAGTTT CTGAATTACA GATATAATAT TGATGTTGTT ATACTTCAAT TGATCAATTC CATTGTATGT GTGAGATAAA
AGTGTTTCGA TATAACTCCT TACTCTTTTT AATCTACCAT TTTTTTCAGT CTTTGATTTT GTCTAACAAC AAAATTAAAA
GGTGGCCTGG CACCGTATTC TCCTCCCTTG CCAGCCTTTC TTTGTTAAAG CTAGACAACA ATCCTTTGGC AGAGGTAATG
TCATGGTCTT CATATCTTTT CTTTTGCAAA TTTCTTGGTA TTGGATCATG ATTCCCTGAT GGGTTAATCT CTGGAAGTTA
ATCAACGTTG ATTATTGAAA TTGAAGAAGT TGATGGTTTA GCTGTTACAA CACTTAGAAG AATTGAACTA CAGGGTGCAG
AGGCAACATG GATAAAGACT TGACATAATT ATAAGCCATC TAGCCTATTA TGTTTAGACA CAAGTCATTT TACATTTTTT
TAGGGATTGT CACATTGTTT CTTTCTTAGC TTTAATACCA TGTTTACAGT TAATGTTTTC TCATGTGCCA AGACATCTTA
GACAAGATTT TTTTTTTTTG GGGGGGGGGG GGGTGGGTGT GTGGGGGTAA TGTGCTGCAT GTATTTCTTG TTCCTACTTT
CAAGAGTTGG AATGACACAT TACCAAAAGA GTGATTATTT ATATATAGCT GACATACTTC GAATCTGCAT GCTAATCTGT
GATATTGTAA CACACTTGTT TTTCCTGCAG ATATTGGCTA CTGATCTTGA GGCCCTGTCT AAACTTGAAG TACTAGATTT
AAGTGGCAGT GCTTCTTCTC TACCTGAACC CTCTGCGGTT TCGAAATTAC CTCACCTAAA GGAACTCTAC CTAAGGTTGT
AACATATGCA AAACATCTAA GCTATGGAGT GTTCTATGGA AGCTTATTTA TTTTTCTCTA TATATGAGCA GACGAATGAA
ACTCCATGGA TTTCCTGATA GTTTATTGGG CTTAAAACTG CTGCGAATTC TTGATCTGAG TCAGAATTAT CTTACATCTG
TGCCAGAGGT AAACACTTGG TTCTCTATTT AAGGAATATG ATTTTCCCCC TCTTTCTATA AATGCTTTTC ACATTCCCAG
GTGCATTTAG AAAGTTTTGA ATGGCACGTG CGCCCTTTTT ATTTGCTTAT GCAAAATCCG TTGCACTTAC ACAGGGTATC
AAAGATTTAA CTTCTTTGAT TGAGCTTGAT CTGTCGGACA ACAATATAAC AACACTCCCA CCTGAGCTGG TAAGTTATTG
GCTTTAATGA TGATGTATCG GATGCACCGA CATCAACTGA AAGTACTGTT TTGAAGTTGT ACGATTCTCA AACTCACTGA
AATCTCTAAT CTTCTTGTGG ACACTATTTT GAGCAGGGTT TGCTTGAGCC TAACCTGCAA GTCTTGAAAC TTGATGGAAA
TCCCCTCAGG AGGTAAGAAG TAGGAACAAA TTGTTGAGCC CATTGCATGC ATGCATACAT TGAAATAGAA ACCCAACTCA
CATGGAACCA TGTAGACCTG TGCTGCTACC GATTTTATAT CGTGCATAAC CATAGGATTC TGCAGTGCTC ACCATATAAT
TCGGAACTAC ATGTGAAAGA ACATTAAAAT GGAAACCATC GTAATGCCAT AATTTTCTCA GGGCATATTT AGAATATGAA
AGGGAAAAAA AAAAGAAAGT TGCAGTTCAG ACATGCACCG GCAGAAAAAT CACTGAACTT CCTGTTGATT TCGTCTGCAG
CATACGGCGG ACTCTGCTGG AGCGAGGAAC GAAAGCAATT CTGAAGTATC TCAAAGAAAA GCTACCTGCT GAATAAATTC
TGGTGGGAAT TAATGTATGC TGCATGATGT TTATTGATCA GTTCGGCCCT CTCGAACTGC AGTTACCTTT TCCTGGAGTC
CATTTATCCC Caaattgttt tttccttgat tgatgtaatt tttgcttggc tatcttcttg gtgatcgtta tcattCTCCT
CATTTTATCC GCGGATTGCT GTCACACTGA AAGCTTCTCA GCTTGTGTAT AACCAACCTT GTATGCAGTA TACAGCAGAT
CAGAATTCGG TTATGTTGTA GTATTTTGAC ACTGGAAGTC CCGCACGTGT GAAAAAAAAT CTGCCGCCAC AAGTGAAACT
TTGTTTCTTG CC

Locus: Os02g0826600

Loading...

Locus: Os02g0826600

Loading...