Os02t0833100-01

Locus

Os02g0833100

Description

Similar to antiporter/ drug transporter.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsFRDL3

Oryzabase Gene Name Synonym(s)

FRD3-like protein 3

Transcript Evidence

AK066423 (DDBJ, Best hit)

Protein Evidence

NP_195551.5 (RefSeq)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

J013061P19 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0833100-01)

Others

Oryzabase (11141)

Transcript

2998 bp

>Os02t0833100-01 Similar to antiporter/ drug transporter.
ATTTCTGATTTCTCCTTTCTCCCCTCGAGTCTGATCCTCCCACTACCAACGTCCACCGGC
ACCGCAACTTGCTGTCCTCTCCTGCCGGCTGGTCCAGCTCCATCTCTCTTCTTGCTCTGC
CTCCCCCTTCAATTTAATTGATTCCTCCATCCAGATTTCGAGATCGAGATGAAGGCAGTG
ATGATGCACCACCATCACGCGGCACGCCCTGCGCGCTGTCCAAGGCCTATCTCTTCCTCC
TCCTCCTCAGCCCTGTTGGGTAGCAGACCAACCAGAGTCTCCTCCCCATCAAACCTGCCA
AAGTTGCTCATAAACCGGCGACACATCACCCCTCTTGCCACCAATGCTCCCCATGCTGTT
GCTGAAGATGATGGCGCCATCTCTTTTGCTAATGCAACGCCAACGGAGCCTCCCATTGAC
TTGCGTCCCGGGGGTGTCAGAAATGAGCTAATTCTTCTAGCTCTACCAGCAGTTCTTGGC
CAAGCTATTGATCCATTGGCGCAATTGATGGAGACTGCATATATTGGTAGATTAGGTATT
ATGGCGCTTGCCCTTCATAAAGTAGCTCTTGGGAGTGCTGAATTATAGCCATCCTTACTG
CATGAAAGCAAGCTGTCCCTTCTTTTGCCATTCATCCTTCTTTTTCATATATTCTGAAGG
GGCTCTGGAGCTAGCATCAGCTGGTATTGGTGTGTCGGTTTTTAATATCGTGTCTAAGAT
TTTCAACATTCCACTGTTGAGCATTGCAACCTCATTTGTGGCAGAAGACATTTCCAAGAA
TGCTAGCAAGCATTCAAGTTCAGGCAAATTGGAGCTGTCATCTGTATCTTCTGCATTGGT
CTTAGCTGCTGGAATCGGTACAATTGAAGCATTGGCATTGTTCCTAGGATCAGGATTGTT
TCTTAAACTAATGGGCGTGTCACCTGCCTCACCAATGCATAAACCTGCAAAACTTTTCCT
TTCATTGAGAGCTTTGGGAGCACCTGCAAATGTGATTATGTTAGCAGTTCAGGGAATATT
TCGTGGATTCAAGGATACTAAGACTCCTGTATTTTTTATAGGTTTGGGAAATCTTTCAGC
TGTAGTGCTTCTTCCTTTACTTATTTACGTCTTTCGGCTTGGCATAACTGGAGCTGCAAT
TTCTACAGTTGCATCACAGTACATTATTACAATTTTGCTTCTCCAGTCTCTAAGTAAAAG
AGCTGTTCTACTTCCTCCAAGGCTGGACCAGTTAGAGTTTAGCGGATATCTAAAATCTGG
TGTCTTTTTCGTTCTTCTATCTCCCCCTCTCTCATTATATTCAATTGTTGTGCATGCTAA
ATCAGAGTTCTTACACTTTCATTGATCTCAGTGTCTGTTCATTTTGTTCATTCTACAATG
TGCGGTTAACTGAAGTTCAGATTTTCTCTCCCAGGGGGCTTTGAGTTCTTTGGGTTAATT
TGTCAAAATTTCCAATTCTGGATCCACTATGCATTTAACAATGATACCTTTATCGATAAC
AAGTTAATTGTAAAGTTTGGTTTTTGAAATAACTTTATATGCAAGAAAAAGGAAAGACTA
TCGTAGAGTAGATGGTGTAGGTACGGTTACTGCTAGTATATTTTACAGATATGTTGATCA
GCTTGTCATTGATAGAGCTTTCATTCATGGGCCATGCCCATTCTGTCCACTAATGAATGG
GCTGTTCAGGGAACTTCTATTCTCCATATTGTTTCGTGGTACCATTTATATGTAGTAAAA
TGTGCTCAATTCTAGGATTTGCAAATATTTGCTGTCATATTATTGGAAAGATAATGCATG
TCTATGATATGCATCCTGAGAACCTCCATGTTATAATTTCATACTTCTTATCTTGTTTTT
CCTTTTATTGCACTTACCACCATCTATAATTCCATCATCTGTTTTTGAAATGCTTAGGTG
GCATGCTGTTAGGAAGAACCCTCTCGATTTTATTAACGATGACCATAGGGACATCAATGG
CTGCTCGACAAGGCCCAACAGCTATGGCAGCTCATCAGATATGCTTACAAGTATGGCTTG
CGGTATCTTTGCTTGCAGATGCTTTAGCTGTTTCTGCCCAGGCAATGATAGCAAGCTCCT
ATGCAATATTGGACTACAAGAGGGTCCAGAAGATAGCAATGTTTGCTTTGCAGGTCATGT
GTCATTTCTCTGTTTTCTATTGTGAAGCTTTGTTTTTCATGTATTCATAGATGCAATCGC
CCTTTCTTGTTAACATAGAAAAATGGAGATTTTCTTGCAGATAGGAGTAGTCAGTGGATT
AGCTTTATCCGCTGGCCTGTATACCTCATTCAGTAATATAGCAAGATTATTTACCAGTGA
CCCTGTGGTCCTAATGGTTGTCAAATCTTGTTCATTGTTTGTATGTGCCAGTCAACCAAT
TAATGCTCTGGCATTCATATTTGATGGTCTGCATTATGGTGTCTCAGATTTTGATTATGT
CGCTCAAGCTACGATTGCTGTTGGGATAATGTCATCATTAGTTTTGTTATATGCTCCATC
TGTTTTTGGACTTGCTGGAGTTTGGGCTGGTTTGACAACACTTATGGGATTGCGCATGGC
TTCGGGCATTCTCAGGCTTCTATGGAAATCAGGACCTTGGTCATTTTTGCATGAGGAACC
CAAAACAGAGCTAGCTGGTTGAAGATGGAGCGGCAACTAAGCAGTCAATACTACGGATTA
AATGAACGAGCGGGTGATTCTGTAGGTATTTATGTTCAAGTCGGTCTGCTAGGAGATGCC
ATTTTTACTTGCTACCAACATTGTTCAATTGCTAGTGTTATTACTATGTGTAGCCGTTTT
ATTTATTCTAAAGGCTCCCTTGTTTCTTGTGGTGGTTTTCGTTTACTGTGTAAGCCAGTT
TGCTGCTGCGTAAACAGCTTGATAAGTTTAGAAGGATAGAGAATTTGCCTTTCTTTAACC
TGAGACCACTTCGAATTATTTTTGGAGCAATGTATACTAATACTGTATTATTCAGTTC

CDS

420 bp

>Os02t0833100-01 Similar to antiporter/ drug transporter.
ATGAAGGCAGTGATGATGCACCACCATCACGCGGCACGCCCTGCGCGCTGTCCAAGGCCT
ATCTCTTCCTCCTCCTCCTCAGCCCTGTTGGGTAGCAGACCAACCAGAGTCTCCTCCCCA
TCAAACCTGCCAAAGTTGCTCATAAACCGGCGACACATCACCCCTCTTGCCACCAATGCT
CCCCATGCTGTTGCTGAAGATGATGGCGCCATCTCTTTTGCTAATGCAACGCCAACGGAG
CCTCCCATTGACTTGCGTCCCGGGGGTGTCAGAAATGAGCTAATTCTTCTAGCTCTACCA
GCAGTTCTTGGCCAAGCTATTGATCCATTGGCGCAATTGATGGAGACTGCATATATTGGT
AGATTAGGTATTATGGCGCTTGCCCTTCATAAAGTAGCTCTTGGGAGTGCTGAATTATAG

Protein

140 aa

>Os02t0833100-01 Similar to antiporter/ drug transporter.
MKAVMMHHHHAARPARCPRPISSSSSSALLGSRPTRVSSPSNLPKLLINRRHITPLATNA
PHAVAEDDGAISFANATPTEPPIDLRPGGVRNELILLALPAVLGQAIDPLAQLMETAYIG
RLGIMALALHKVALGSAEL*

5'UTR

chr02:35825448..35825615 (+ strand) : 168 bp

CDS

chr02:35825616..35825863 (+ strand) : 248 bp

chr02:35826013..35826131 (+ strand) : 119 bp

chr02:35826315..35826367 (+ strand) : 53 bp

3'UTR

chr02:35826368..35826582 (+ strand) : 215 bp

chr02:35826696..35826817 (+ strand) : 122 bp

chr02:35826981..35827116 (+ strand) : 136 bp

chr02:35827368..35827464 (+ strand) : 97 bp

chr02:35827847..35828769 (+ strand) : 923 bp

chr02:35828973..35829268 (+ strand) : 296 bp

chr02:35829340..35829435 (+ strand) : 96 bp

chr02:35829506..35829627 (+ strand) : 122 bp

chr02:35830393..35830447 (+ strand) : 55 bp

chr02:35830971..35831318 (+ strand) : 348 bp

FASTA

>Os02t0833100-01 class=Sequence position=chr02:35825448..35831318 (+ strand)
ATTTCTGATT TCTCCTTTCT CCCCTCGAGT CTGATCCTCC CACTACCAAC GTCCACCGGC ACCGCAACTT GCTGTCCTCT
CCTGCCGGCT GGTCCAGCTC CATCTCTCTT CTTGCTCTGC CTCCCCCTTC AATTTAATTG ATTCCTCCAT CCAGATTTCG
AGATCGAGAT GAAGGCAGTG ATGATGCACC ACCATCACGC GGCACGCCCT GCGCGCTGTC CAAGGCCTAT CTCTTCCTCC
TCCTCCTCAG CCCTGTTGGG TAGCAGACCA ACCAGAGTCT CCTCCCCATC AAACCTGCCA AAGTTGCTCA TAAACCGGCG
ACACATCACC CCTCTTGCCA CCAATGCTCC CCATGCTGTT GCTGAAGATG ATGGCGCCAT CTCTTTTGCT AATGCAACGC
CAACGGAGCC TCCCATGTAA TTTCCAGTTT CCTACTTTTA TTTACTTGCC TACCCACATG CTTGCGCCCT TTGCATTTGC
TGTCTACATT TACTATAATC TTTACATTTC GGAGGTGCAT GACATATTTT ACCCTTTCAT AACCATCCAA CGAATAAACA
ACCAGTGACT TGCGTCCCGG GGGTGTCAGA AATGAGCTAA TTCTTCTAGC TCTACCAGCA GTTCTTGGCC AAGCTATTGA
TCCATTGGCG CAATTGATGG AGACTGCATA TATTGGTAGA TTAGGTAGGT ACCTACTGGA CCTGCTATAT CCTATATTTT
TAAGTGTTCT TTTCTTAATG GTTTATCAAT CGGCAAATAG GTAGATACCT GCACCATCAT TGTCTACACT AATACTCTAT
AATTCATGCT GTTTGTTTCT TTTATATTAT GTAACTAATT CAAACAGCAC CAAAAATGAT GTTCTAGGTA TTATGGCGCT
TGCCCTTCAT AAAGTAGCTC TTGGGAGTGC TGAATTATAG CCATCCTTAC TGCATGAAAG CAAGCTGTCC CTTCTTTTGC
CATTCATCCT TCTTTTTCAT ATATTCTGAA GGGGCTCTGG AGCTAGCATC AGCTGGTATT GGTGTGTCGG TTTTTAATAT
CGTGTCTAAG ATTTTCAACA TTCCACTGTT GAGCATTGCA ACCTCATTTG TGGCAGAAGA CATTTCCAAG AATGCTAGCA
AGCATTCAAG TTCAGGTAGC AGCAGCATAT ATTAAATAAA TATTCCATTT CTCACATATT TATAAATTTT TTTTGTGCAC
TTGCTTCAAC ATTCAAGCAA TAAAACCTGA CTTGTGGTTA TGTTGCAGGC AAATTGGAGC TGTCATCTGT ATCTTCTGCA
TTGGTCTTAG CTGCTGGAAT CGGTACAATT GAAGCATTGG CATTGTTCCT AGGATCAGGA TTGTTTCTTA AACTAATGGG
CGTGTCACCT GTATGTTTTG GATTACGATG CCTATTCTTG TCTGCGATCT TTGTTTTGTA GGGAATACTG TCGTTTTTAT
GTGCACTTTT GGACAATGGG TCACTAATTT GATTCAACAA TTAGTTTTCA ATTGTTGGAA TTGTCAGGAT ATCTCAACTT
AGTGCTTTTG CAGGCCTCAC CAATGCATAA ACCTGCAAAA CTTTTCCTTT CATTGAGAGC TTTGGGAGCA CCTGCAAATG
TGATTATGTT AGCAGTTCAG GGAATATTTC GTGGATTCAA GGATACTAAG ACTCCTGTAT TTTTTATAGG TAACTTCCAA
GAACTACTCT TCATCAACCA CATGATTACA TTGGTTTGCA TTAGTTATAT TCCTTTTAGC AGTCCTAGCA AATATTTTGT
GGAATCACAA TAATGTTTCC AATATCTTTT TTTTCCATTT TCCACAATAA AGGGCATACT TTACGTCCAG TTTCATTTGA
TTCCAGACTC TTCTCTGATA TCAAATATCT CTCATATTAC ACTATATGAT GTCTGTACCA TGTTCTTTTA AAACATGTAG
GTTTGGGAAA TCTTTCAGCT GTAGTGCTTC TTCCTTTACT TATTTACGTC TTTCGGCTTG GCATAACTGG AGCTGCAATT
TCTACAGTTG CATCACAGTA AGTTCTATAT TGATACCTAG CCCCATGGAA TCCAAGTAAA ACAACAAAGG TAAAAAAAGG
GAATATTTTA TATGAATATA GCAGCAAATA ACTCAGTTTG GTTCCAAATA CCAACTGTTT TTACTTATAG ACATGTTTCT
AAAATAATGA AATGCAGCAG AAAATAAACT TTAGCTTTCC TTTTGTTTTT CATTTATCAG CAATTCAGCA CACACATTTA
AATTACCATA TGTGATTCTG GTCTTGCCAT AACAGTTTGT GGCTGTTAGC ACATCATCTG ATGTTTATGC AGTTTATTTA
TTCATATGTT ACATATCAAG CATTTTTGCT AGTTACAACT TACAAGTGGA GTTCTAACTT TATTCCGTCC ATGACATAGG
TACATTATTA CAATTTTGCT TCTCCAGTCT CTAAGTAAAA GAGCTGTTCT ACTTCCTCCA AGGCTGGACC AGTTAGAGTT
TAGCGGATAT CTAAAATCTG GTGTCTTTTT CGTTCTTCTA TCTCCCCCTC TCTCATTATA TTCAATTGTT GTGCATGCTA
AATCAGAGTT CTTACACTTT CATTGATCTC AGTGTCTGTT CATTTTGTTC ATTCTACAAT GTGCGGTTAA CTGAAGTTCA
GATTTTCTCT CCCAGGGGGC TTTGAGTTCT TTGGGTTAAT TTGTCAAAAT TTCCAATTCT GGATCCACTA TGCATTTAAC
AATGATACCT TTATCGATAA CAAGTTAATT GTAAAGTTTG GTTTTTGAAA TAACTTTATA TGCAAGAAAA AGGAAAGACT
ATCGTAGAGT AGATGGTGTA GGTACGGTTA CTGCTAGTAT ATTTTACAGA TATGTTGATC AGCTTGTCAT TGATAGAGCT
TTCATTCATG GGCCATGCCC ATTCTGTCCA CTAATGAATG GGCTGTTCAG GGAACTTCTA TTCTCCATAT TGTTTCGTGG
TACCATTTAT ATGTAGTAAA ATGTGCTCAA TTCTAGGATT TGCAAATATT TGCTGTCATA TTATTGGAAA GATAATGCAT
GTCTATGATA TGCATCCTGA GAACCTCCAT GTTATAATTT CATACTTCTT ATCTTGTTTT TCCTTTTATT GCACTTACCA
CCATCTATAA TTCCATCATC TGTTTTTGAA ATGCTTAGGT GGCATGCTGT TAGGAAGAAC CCTCTCGATT TTATTAACGA
TGACCATAGG GACATCAATG GCTGCTCGAC AAGGCCCAAC AGCTATGGCA GCTCATCAGA TATGCTTACA AGTATGGCTT
GCGGTATCTT TGCTTGCAGA TGCTTTAGCT GTTTCTGCCC AGGTGTGTAT CTTTGATTGT ACATGGTATC CACACTTTTA
AATCGGCTTC ATTTCACATA CTTCTTTCTT TATAAATTGT AATTTACATC GAGCCCTCAA ACTTCTAGCG AATACTACTA
ATACAAAGAT TGTTCCTCTA GCTCAATGAT ATATCATGAT TTGTGCAATC AAAATGTTCA GACTTAAGTT TACTTGCATT
TGTAGGCAAT GATAGCAAGC TCCTATGCAA TATTGGACTA CAAGAGGGTC CAGAAGATAG CAATGTTTGC TTTGCAGGTC
ATGTGTCATT TCTCTGTTTT CTATTGTGAA GCTTTGTTTT TCATGTATTC ATAGATGCAA TCGCCCTTTC TTGTTAACAT
AGAAAAATGG AGATTTTCTT GCAGATAGGA GTAGTCAGTG GATTAGCTTT ATCCGCTGGC CTGTATACCT CATTCAGTAA
TATAGCAAGA TTATTTACCA GTGACCCTGT GGTCCTAATG GTTGTCAAAT CTTGTTCATT GGTACATCTC CCTACTTTAT
CATTTAGTTA TCACATCACA TCTATTATTC TAATGTTTTT TCTTCATTTC AGTTTGTATG TGCCAGTCAA CCAATTAATG
CTCTGGCATT CATATTTGAT GGTCTGCATT ATGGTGTCTC AGATTTTGAT TATGTCGCTC AAGCTACGGT ATGGAAACAC
TTGTCTCTCT TTTTTCTTTA CTTTATATTG ATTTCTTTGT CATCTTTTGG CTATACAGAT TGCTGTTGGG ATAATGTCAT
CATTAGTTTT GTTATATGCT CCATCTGTTT TTGGACTTGC TGGAGTTTGG GCTGGTTTGA CAACACTTAT GGGATTGCGC
ATGGCTTCGG GCATTCTCAG GTGATTATAT TTCTTGTTTT GTTGTTCTAA TCCGGTGTAA AAAGACAAGC ATGCATACAT
GATCTTGCAG TTAAAAATGT TTGCCTTTTT GGGAATGAAT ATCTTGTGTT GTTCTGTAAC CGTAAACCAT AGCCATGTAA
GTGATCTCTC TCTCTCTCCG TGTGCGCGCG CGCGCGTGTG TGCCCTGCTA TTTTATTGAA CTAAGTGGAT GTGGTTCAAC
TGTGAAAATG CAAATTATAG TTCTTGCAGA CTTGGGAATA AACTTGCTAC ACATGCCCTA TGTTCTAGGT TATTTGGCAA
TTGATTAGGG TGACTGTATT TGCTAAAAGC ACTATGTTAA GTAAGCAATG TGACGTCTAT AGCGGTCGAA ATATGTTACT
GCCACAATAA GTAACATATT TGCATGTTAT CTTGAAGATC AACTTATTTT CTATATGAAA GTTGTAACCT TTCAGGGAGC
ATGTAAACTA ATTGACTGTT CAGTGAATTG CCACGCATAT TTTGCAGTTT ATTTAGGAGA ACATAACTAA TAGTTTCATG
TGGATAGGAC AAATTTCTGT TATTTGATGT ATATCCATGC ACTGGGCAGT ATATTGTATA AGGGTATCTT CCCAATTTTC
ATCACTTTTA TGAATATAAC AATTGGCGAT AAAGAATTTT TAATATTATG TCTGTTTCCC TTTTGGAGCC TTGTATTTCA
TGTTCTGTAA TTGATCTAAT GGATGCTCTT TTATGCTTTT ATCTTAATAA TTTGAGAAAT CGCAGGCTTC TATGGAAATC
AGGACCTTGG TCATTTTTGC ATGAGGAACC CAAAACAGAG GTTTGATGTT CCTATCTTTT ACACCCTGGT ATTAGTTTAT
AAATTGTCTT GTCCTCTGCA TTATAATTTT TTTTCTTGGG TAAGGCTCTT AACTTAAGAG GTATAGTGTC AAATCAATGC
AAATTACGAT AACCTGTTAA ATTTGCCCGC CGTCATTTGT TGAGTATCAC ACGCTAGTCA GCTCACCTTA AAAGAAGAAT
CTGTTAGGGA AATGCAGGAG CAAGGCATTC AGTAGGCTCA CTAGCCTACA GTCATGGGGA TTCATATTGA GAAAAATATT
TTTTTTGAAA GATCCGGTCG TATTGAGAAA AATATGAGAT AGCCTATCCC TGTTGATTTG ATGATTTGAG GCATGCAACC
TAATATGTTG TACTGTTGAT TTTTTATGGC CATGCTTGTG AAGGTAGGAG TAATAGAGAA GGGCAGTATC CATATTTTTC
TGGTTTTCTT TTCCCCGCAT GATTCTGTCG GAGCGGTTTG TGAATGTCAT GATAAGTGCA GCCATTGCAT AACTCTTGTG
CAGCTAGCTG GTTGAAGATG GAGCGGCAAC TAAGCAGTCA ATACTACGGA TTAAATGAAC GAGCGGGTGA TTCTGTAGGT
ATTTATGTTC AAGTCGGTCT GCTAGGAGAT GCCATTTTTA CTTGCTACCA ACATTGTTCA ATTGCTAGTG TTATTACTAT
GTGTAGCCGT TTTATTTATT CTAAAGGCTC CCTTGTTTCT TGTGGTGGTT TTCGTTTACT GTGTAAGCCA GTTTGCTGCT
GCGTAAACAG CTTGATAAGT TTAGAAGGAT AGAGAATTTG CCTTTCTTTA ACCTGAGACC ACTTCGAATT ATTTTTGGAG
CAATGTATAC TAATACTGTA TTATTCAGTT C

Locus: Os02g0833100

Loading...

Locus: Os02g0833100

Loading...