Os02t0834000-02

Locus

Os02g0834000

Description

Similar to Rop4 small GTP binding protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RAC5

CGSNL Gene Name

RAC/ROP-TYPE GTPASE 5

Oryzabase Gene Symbol Synonym(s)

Osrac5, OsRac5, RACD, OsRacD, OsRACD

Oryzabase Gene Name Synonym(s)

small GTP-binding protein 5, Rac-like GTP-binding protein 5, GTPase protein RacD

Transcript Evidence

AK067796 (DDBJ, Best hit)

Protein Evidence

Q6EP31-2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: GTP catabolic process (GO:0006184)

Biological Process: signal transduction (GO:0007165)

Biological Process: small GTPase mediated signal transduction (GO:0007264)

Biological Process: protein transport (GO:0015031)

Cellular Component: intracellular (GO:0005622)

Cellular Component: membrane (GO:0016020)

Molecular Function: GTPase activity (GO:0003924)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Small GTPase superfamily (IPR001806)

Small GTPase superfamily, Rho type (IPR003578)

Small GTPase superfamily, Rab type (IPR003579)

Small GTP-binding protein domain (IPR005225)

Small GTPase superfamily, Ras type (IPR020849)

Full-length cDNA

J013116I24 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0834000-02)

RiceXPro (AK067796)

Others

Oryzabase (6291)

KEGG (Os02t0834000-02)

Transcript

1100 bp

>Os02t0834000-02 Similar to Rop4 small GTP binding protein.
GAGGTCCGTGGCGTTGGAGTGAGGACTGAGGAGGAAGAAGAGGGCGGGATCTAGGGTACC
GGATGCGCTGGCTGTGCTGAGTGAGAGTAGAGATGAGCGCGTCTCGGTTCATCAAGTGCG
TCACCGTGGGGGACGGCGCCGTGGGCAAGACCTGCATGCTCATCTCCTACACCTCCAACA
CCTTCCCCACGGACTATGTTCCAACTGTTTTTGATAACTTCAGTGCAAATGTTGTGGTCG
ATGGGAGCACTGTGAACTTGGGGTTGTGGGATACAGCAGAGGACTACAATAGGCTACGCC
CGTTGAGCTATCGTGGCGCTGATGTTTTCCTGCTGGCCTTTTCTCTGATCAGCAAAGCAA
GCTATGAGAATGTTTCTAAAAAGTGGATACCTGAATTAAGGCATTATGCTCCTGGTGTGC
CAATAATTCTCGTTGGAACAAAGCTTGATCTGCGGGATGATAAGCAATTTTTCGTAGATC
ACCCTGGTGCTGTACCTATTTCCACTGCTCAGGGCGAAGAGCTGAGGAAACTCATTGGTG
CAGCGGCATACATTGAATGCAGTTCAAAAACACAGCAAAACATCAAGGCAGTTTTCGATG
CTGCGATTAAGGTGGTTCTCCAGCCTCCAAAGCAAAAGAAGAAGAAGAAAAAGGCGCAGA
AAGGATGTGCCATCTTGTAATTAAATGGTAGACAGTGCAGTGCAGATCGATGTATCCCTT
CATTTGTAGCCTCTGGCTTCAATCGTCGCTTGTTTGTATAATTACGCTAGATGCCACCGG
CAGAAGATATAATATAGTCCTCCTGCCTTTGTGGTGTTGGTCTCTAAGGTCGTCCAGACT
CCAGAGTCCAGACGCATTTGGTTTCTTTTGTTCTATCTATAATCAATCTATCTATATCTG
CTAGTGTTGTGCTTCTGCTAGTTATGCGGATGAGAAAGGGAATTTACCTTCCCTGTTTCT
GGGCTTCTGGCTTGCACGGGAAAGGTCGGTTTGTTTGCAATATACTACTACCACTCCAGC
TTGCTAGGTTGATTAAAATAAGCTACCAGTAAGAATCGATATGACGTATCAGCATTTTAT
TAAATCAGTGATTAATTTTA

CDS

588 bp

>Os02t0834000-02 Similar to Rop4 small GTP binding protein.
ATGAGCGCGTCTCGGTTCATCAAGTGCGTCACCGTGGGGGACGGCGCCGTGGGCAAGACC
TGCATGCTCATCTCCTACACCTCCAACACCTTCCCCACGGACTATGTTCCAACTGTTTTT
GATAACTTCAGTGCAAATGTTGTGGTCGATGGGAGCACTGTGAACTTGGGGTTGTGGGAT
ACAGCAGAGGACTACAATAGGCTACGCCCGTTGAGCTATCGTGGCGCTGATGTTTTCCTG
CTGGCCTTTTCTCTGATCAGCAAAGCAAGCTATGAGAATGTTTCTAAAAAGTGGATACCT
GAATTAAGGCATTATGCTCCTGGTGTGCCAATAATTCTCGTTGGAACAAAGCTTGATCTG
CGGGATGATAAGCAATTTTTCGTAGATCACCCTGGTGCTGTACCTATTTCCACTGCTCAG
GGCGAAGAGCTGAGGAAACTCATTGGTGCAGCGGCATACATTGAATGCAGTTCAAAAACA
CAGCAAAACATCAAGGCAGTTTTCGATGCTGCGATTAAGGTGGTTCTCCAGCCTCCAAAG
CAAAAGAAGAAGAAGAAAAAGGCGCAGAAAGGATGTGCCATCTTGTAA

Protein

196 aa

>Os02t0834000-02 Similar to Rop4 small GTP binding protein.
MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD
TAEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKLDL
RDDKQFFVDHPGAVPISTAQGEELRKLIGAAAYIECSSKTQQNIKAVFDAAIKVVLQPPK
QKKKKKKAQKGCAIL*

5'UTR

chr02:35880895..35880986 (+ strand) : 92 bp

CDS

chr02:35880987..35881085 (+ strand) : 99 bp

chr02:35881754..35881841 (+ strand) : 88 bp

chr02:35881951..35882052 (+ strand) : 102 bp

chr02:35882157..35882222 (+ strand) : 66 bp

chr02:35884417..35884481 (+ strand) : 65 bp

chr02:35884568..35884633 (+ strand) : 66 bp

chr02:35885151..35885252 (+ strand) : 102 bp

3'UTR

chr02:35885253..35885672 (+ strand) : 420 bp

FASTA

>Os02t0834000-02 class=Sequence position=chr02:35880895..35885672 (+ strand)
GAGGTCCGTG GCGTTGGAGT GAGGACTGAG GAGGAAGAAG AGGGCGGGAT CTAGGGTACC GGATGCGCTG GCTGTGCTGA
GTGAGAGTAG AGATGAGCGC GTCTCGGTTC ATCAAGTGCG TCACCGTGGG GGACGGCGCC GTGGGCAAGA CCTGCATGCT
CATCTCCTAC ACCTCCAACA CCTTCCCCAC GGTAGGCAAT CCGTTCTTTC CCCCCTTCTT CTTCTCGATC CTTCCTGCCC
GCCCGAGTAT GCATCTGATC GACTCCATGG TAAACATTCT TTTTCTTGTC TTGGGACTGG GGACTGGGGA CTGGGTGTAG
AGAAGACATA GATCAGCTTT CCTTCCCTTT TTGCTTGCTA AAATTTGGGG ACTGATGATT ATGATAACGT TATTCTTCTA
TACGCGTCCT TCTCTCTGCG GGATCCAGGT GCCTTCTTCT CCAGGTATAG GAATTAGGAT AGTATTGCCG ATTTCTCAGC
TGCCAACATT CACTCCTTAT ACAGATCTAA ATATACACTC TTTAGCTTCA CCTCCAGATT TTGTTGTATT ACTATCAGGA
GTAAATAATA AACTCATAAA TATATGTTGC GGTATGTCTG ACTTTTTGTC TGCTATTACT AACCGTGGCT CCATCATTCC
GTAGCTAATC GCCACCATTG ACCTCTAGAC GTTTCTCTTT GTTGGTGAAT TTGTTTTAGC TCTGTATCAT TCTAACCGTG
ACCTCTGTCA ATCACCGTCA GTAACTCAGC TACCCCTTTT CGTTTTGTGC GAAAAAATAA ATCTAATGTA TTGCATCTTT
GCATTTTTAA TTGGCAGACT GTATGTTTAA TGGGACATTT CTTCATCTCT ATGTTACAGG ACTATGTTCC AACTGTTTTT
GATAACTTCA GTGCAAATGT TGTGGTCGAT GGGAGCACTG TGAACTTGGG GTTGTGGGAT ACAGCAGGTT CTACTTTCCC
CTCCTTTTAA TGGATGCATG CGTAAACCTC CTTATATACA TCCACCTTTC ACGGTCATCA AAATAAATAA AAATTTGACA
AATTTAACAG GACAAGAGGA CTACAATAGG CTACGCCCGT TGAGCTATCG TGGCGCTGAT GTTTTCCTGC TGGCCTTTTC
TCTGATCAGC AAAGCAAGCT ATGAGAATGT TTCTAAAAAG GCAATAAAAT CTTGCCGCCC ACTTTCTTTG CTCTCTCTCC
ATGAAGTACC TTAGCTTAGT CAACCTGTTA TCTTGCACTG ACACATATAT ATTTCTGTTG TCAGTGGATA CCTGAATTAA
GGCATTATGC TCCTGGTGTG CCAATAATTC TCGTTGGAAC AAAGCTTGGT ATGCCCTTCC AACTCTTGTT GCATAGCATT
TGTGCAAAGC ATCACATATC TGTAGAATTA AGCTATTATA TTTTCACTCC CACTTACCAG CAGCTTGGCG TTGCACTTAA
CTGAGTGGTG ATTGCTGTCT TCCTATAAAT TGTCTCATCA TTTGAGTGCT TGTGTGCTGT GAACACTCTA TGAAAGCATG
TTTGTATATG TAAATTCAAT TTTACTGTTA TTCACAGCAA AGCCATATGC TTATGATATC TGAAAATCAT ATTTAAATGT
AAAATATTTG CATGTGGAAA TCTATGTGAA CATGGTTTCA TGGAAGACAA GATATTTGAA TTCGACGATA GCATGATTGC
TGCCCAGCAG TGTTTTGACT GAATATATGG CATTATACCT TGAAACATGT TACCTGTAAC ACATGAAGTG TTATATGCTA
TCAGGGGACA TTTGTAGATG CTTGGTGACC TGGTGTCCCT CAGGATTGCA GGACATGCAT TATATCAAGA ATGTTTGTTT
TTTGGTGGGT GACATCCTTA GACTAACGCT GAATGTTTTT TTTTTTCAAA TTTAGATTTT GTGGGGAATC GGTAGCTAAG
AGTCTCTTAT TCCACTATGG GTGGCATAGT TCCATTAGAA TTGCTGGATA AAAAATCTAT GTGGTTTAAT GCTAGTCAAT
AATAAAGGAG AGTTAAGGGT TTGTCCAGGG CCGTCTCCAG GAATTGGGGG CCCCGGAGCG AAATATAATT TGAGATCCTA
AATTTACTTT TGATTCGGTC CTTAATTTAA ATTCGTAATT ATATTCATGG TAATTTGATT TGAAAAGAAG AGTACTGAAA
TATTCAATTG ATCATTACAT GCATGCAATT CAACAATTGA GTATCAACAA TTCAGTATTA GAAACTCTAA TATGATAGAC
GAGGTAGTCG GCCAGCTGCT CTGGGCATCG TAACCATTGA TCAAGGATTC AGAAGCTGGT TCGCATGCAT GCACATGAAC
ACACACATGA CATCAGTTGT ATATGCTAAG GCTGGCTGGT TGTACTGGTC TCTCTGATTT GGGGGCCCCA AATTTTTGTG
GGGCCCTGCG CTGACGCTCC GTTGGCACGC CCTCGTTGAC GGGCCTGGGT TTGTCCCATC ACCTTATGGC TCATTTTCCT
GTTTTGAACA AACTTATGGC TGTCTTATGG TAGAAAGCTG GAGATGTAAA TCATTTCCAT TATCTAAGAA TGTTTGAAAT
TAATGCTTTC TTTTTTTGCT TGATTGTTAA CCATTACCTC AGCAACATTT CACATGCTAT GACAgttgag tatcatagct
agtttgagag acaaatgagc atgcaatggt tttgtttgta tttcattgag accttgacga tcctgccctg caaatgggtc
tttactagtc tccaaagtta agcctgtgac ctatactcca gttggtcctg tacatatcac ttattgattt atgatcaaga
aaagaaAATT CCTCTGAAAT ATATTTTGTC TTGTTCCTTC AGCAAATGCT AAATGTTGAT AAATCTGCAT TTCTAGTTTT
CATGCTAAGT TGCTAATAAA AAGGCACATA TGACCCGATC CAATACCTTA CACTGCATGA TTGAATACCA TGAGAATTCC
ATTCTGTTGA TCTCACAAGG CAGGTGGGCT TTTAGGATTG TCCCCTGGGA ACACATCCTC TGTAGGCTAT TTATTCACGG
TTTCATACTG CATGCTCAGT TAAAATGGCA TCTAGCGAAC ATTTGAAAGG CTCAAAATGG ATGTTCACCA TTGAATTTCT
GCTCCAGCGG AGCAAGTTAT AAATAGATAA AGCCTGTACA GCTAACAGCA AGTTATAAAT AGATAAAGCC TGTACAGCTA
ACAGCCTTGT CAACTTACTG GCCTTAGAGG CAAGTTAGGT GGTTAGAGAC TTAGTCCTCA CTGACCAAAA TGGGCTCTTG
TTAGATTATG TTCTTAAGTT GGATTACTGG AGTTAGAAAT CAGGTTCGAT GTAGCAGCTT TGGTGGTGCA AGTTGTACTT
TGCTCCTGAT ACAATCATAC ACAATATAGT TTTCAGAAAC ATGTCCTAGC CTCAGCATGT AAATGCAATA TTCTTTTGCT
TTTCTGTTCA TTGTGCTTTT ATTAATCACT TGCGTACTTG ATGTAATCCG GCGGTGCTTA ACCATTAAGT TACTGTTAAT
AGATCTGCGG GATGATAAGC AATTTTTCGT AGATCACCCT GGTGCTGTAC CTATTTCCAC TGCTCAGGTA TTCAAAGCTT
AGTTTGCTTG TATTTTTGTT GCTTCCCAGC ATTGTTACAC AAGTCATTAA AATTATTTTG CTAATCAATG TAGGGCGAAG
AGCTGAGGAA ACTCATTGGT GCAGCGGCAT ACATTGAATG CAGTTCAAAA ACACAGCAAG TACTACATTT TATTCTTCTT
TTTTGAAAAA GGGTTCATTT TACTCCCTCA AATTATTTTG CCAAAGGGCC TAGGTTTTTA TGGTTCACCC CTTAAACTAG
TAAAAGGGAC TCTACTCCCT AATACCATTT CACTTTTTTA TTCTCCACAT ACGGCAACAG GACCTGTGTT TACAGTTTTT
TCATGACAAT TGACATGCGG TTTTAAATCT CCATGTTTAA TCAGTGttag gtgcttgcaa cttgtgcaaa cagtgatctt
ttaaatatat aaaaaggttg agacatatgg tgtaatacga tttatcatcc cacaaactta acatacaact tttataaaga
gaaacaaaaa ATAGTGAGCC CAAATATAGT TGAGGGGTTT GATTGCTGAT CCGGTGATTT TTGAATCAAT GCTGATCCGG
TGATATAGTT GAAGGGAGTA AAATGGACTT GTTGCGTTGA GCTCCATTGC GGTGGCATGG TTACTGATTG CTGCTGCTTT
GCCTTTGCAA CTGCAGAACA TCAAGGCAGT TTTCGATGCT GCGATTAAGG TGGTTCTCCA GCCTCCAAAG CAAAAGAAGA
AGAAGAAAAA GGCGCAGAAA GGATGTGCCA TCTTGTAATT AAATGGTAGA CAGTGCAGTG CAGATCGATG TATCCCTTCA
TTTGTAGCCT CTGGCTTCAA TCGTCGCTTG TTTGTATAAT TACGCTAGAT GCCACCGGCA GAAGATATAA TATAGTCCTC
CTGCCTTTGT GGTGTTGGTC TCTAAGGTCG TCCAGACTCC AGAGTCCAGA CGCATTTGGT TTCTTTTGTT CTATCTATAA
TCAATCTATC TATATCTGCT AGTGTTGTGC TTCTGCTAGT TATGCGGATG AGAAAGGGAA TTTACCTTCC CTGTTTCTGG
GCTTCTGGCT TGCACGGGAA AGGTCGGTTT GTTTGCAATA TACTACTACC ACTCCAGCTT GCTAGGTTGA TTAAAATAAG
CTACCAGTAA GAATCGATAT GACGTATCAG CATTTTATTA AATCAGTGAT TAATTTTA