Os03t0103300-01

Locus

Os03g0103300

Description

Hybrid proline- or glycine-rich protein, Controll of low-temperature germinability, Pre-harvest sprouting resistance

RAP-DB Gene Symbol Synonym(s)

qLTG-3-1(t), qLTG-3-1(t), qLTG3-1, OsHyPRP05, OsHyPRP5, HyP/GRP05, HyP/GRP5

RAP-DB Gene Name Synonym(s)

low-temperature germianability (QTL)-3-1(t), hybrid proline- or glycine-rich protein 5

CGSNL Gene Symbol

HYPRP5

CGSNL Gene Name

HYBRID PROLINE- OR GLYCINE-RICH PROTEIN 5

Oryzabase Gene Symbol Synonym(s)

qLTG-3-1(t), qLTG3-1, OsHyPRP05, OsHyPRP5, HyP/GRP05, HyP/GRP5

Oryzabase Gene Name Synonym(s)

low-temperature germianability (QTL)-3-1(t), hybrid proline- or glycine-rich protein 5, Hybrid Proline-Rich Protein 5

Transcript Evidence

AB510406

AB433794

AB369214 (Italica Livorno)

Protein Evidence

Q10T25

Literature

PMID: 18719107

PMID: 20145904

PMID: 20960223

PMID: 25309566

Note

Manual Curation

January 13, 2016

Functional domain (InterPro)

Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain (IPR016140)

Hydrophobic seed protein (IPR027923)

Expression Databases

TENOR (Os03t0103300-00)

Others

Oryzabase (2930)

Transcript

941 bp

>Os03t0103300-01 Hybrid proline- or glycine-rich protein, Controll of low-temperature germinability, Pre-harvest sprouting resistance
ATCTGAATACACTGGCTAGCAAGCAAAGCTAGGTAGAGGCCAGGCCATAGATCGAGATCG
ATCTGCAGGTGCAGTGCGGTGGGTGGGCATGGCGACGAAAGCTGGGGTGATCGCCACGCT
CCTGGCCCTGAACCTCCACTTCTTCACCTTCTCCGACGCGTGCGGCTGCCAGTGCGGCTC
ATGCCCTAGTCCCGGCGGAGGAGGCGGTGGCGGTGGCGGTGGCGGTGGCGGTGGTGGAGG
GCGTGGAGGTGGTGGCGGGAGCGGCGGAGGTTCAGGTGGAGGCGGCGGTTCAGGTGGAGG
AGGAAGCGGCGGCGGAGGTTCAGGCGGTGGAGGAAGCGGAGGCGGCGGAGGAGGAGGAAG
CGGCGGCGGCGGGGGAGGAGGAAGATGCCCGATCGACACGCTGAAGCTGGGGGTGTGCGC
GAACGTGCTGAATGGGCTGATAAACGTGCAGCTGGGGACGCCGCCGCGGCAGCCGTGTTG
CAGCCTCATCCAGGGCCTCGCCGACCTTGAGGCCGCCGTGTGCCTCTGCACCGCCCTCCG
CGCCAACATCCTTGGCATCAACCTCAACCTCCCCATCAACCTCAGCCTCCTCGTCAACTA
CTGCGGCCGCTCCGTCCCCTCCGGCTTCCAGTGCAGCAACTAATATAGCTGCTGCTCCAT
TCTACTTCACTGCTTGCTACACACAAGAACGTACGAAGAACGACCACCAGGCCACGTACA
ACTATATATCTATCTATGTCTAATTTGTTCCTTGTTCAAATCATCATATGTATCTGCGTG
CCTTAATTTCCTCCTTCATCCCGTAAATTAATGAGATATATATGCATGCATATGATTCAG
TTCCACGACGTAATTAAAGCATGCTTCATTCGTCTACTTGTATATGTGTATCTGCATAAT
TGATTAATTAATTTGTACTCGATGGATCTCATCGTATATGC

CDS

555 bp

>Os03t0103300-01 Hybrid proline- or glycine-rich protein, Controll of low-temperature germinability, Pre-harvest sprouting resistance
ATGGCGACGAAAGCTGGGGTGATCGCCACGCTCCTGGCCCTGAACCTCCACTTCTTCACC
TTCTCCGACGCGTGCGGCTGCCAGTGCGGCTCATGCCCTAGTCCCGGCGGAGGAGGCGGT
GGCGGTGGCGGTGGCGGTGGCGGTGGTGGAGGGCGTGGAGGTGGTGGCGGGAGCGGCGGA
GGTTCAGGTGGAGGCGGCGGTTCAGGTGGAGGAGGAAGCGGCGGCGGAGGTTCAGGCGGT
GGAGGAAGCGGAGGCGGCGGAGGAGGAGGAAGCGGCGGCGGCGGGGGAGGAGGAAGATGC
CCGATCGACACGCTGAAGCTGGGGGTGTGCGCGAACGTGCTGAATGGGCTGATAAACGTG
CAGCTGGGGACGCCGCCGCGGCAGCCGTGTTGCAGCCTCATCCAGGGCCTCGCCGACCTT
GAGGCCGCCGTGTGCCTCTGCACCGCCCTCCGCGCCAACATCCTTGGCATCAACCTCAAC
CTCCCCATCAACCTCAGCCTCCTCGTCAACTACTGCGGCCGCTCCGTCCCCTCCGGCTTC
CAGTGCAGCAACTAA

Protein

185 aa

>Os03t0103300-01 Hybrid proline- or glycine-rich protein, Controll of low-temperature germinability, Pre-harvest sprouting resistance
MATKAGVIATLLALNLHFFTFSDACGCQCGSCPSPGGGGGGGGGGGGGGGGRGGGGGSGG
GSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSGGGGGGGRCPIDTLKLGVCANVLNGLINV
QLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGINLNLPINLSLLVNYCGRSVPSGF
QCSN*

5'UTR

chr03:219979..220066 (+ strand) : 88 bp

CDS

chr03:220067..220621 (+ strand) : 555 bp

3'UTR

chr03:220622..220919 (+ strand) : 298 bp

FASTA

>Os03t0103300-01 class=Sequence position=chr03:219979..220919 (+ strand)
ATCTGAATAC ACTGGCTAGC AAGCAAAGCT AGGTAGAGGC CAGGCCATAG ATCGAGATCG ATCTGCAGGT GCAGTGCGGT
GGGTGGGCAT GGCGACGAAA GCTGGGGTGA TCGCCACGCT CCTGGCCCTG AACCTCCACT TCTTCACCTT CTCCGACGCG
TGCGGCTGCC AGTGCGGCTC ATGCCCTAGT CCCGGCGGAG GAGGCGGTGG CGGTGGCGGT GGCGGTGGCG GTGGTGGAGG
GCGTGGAGGT GGTGGCGGGA GCGGCGGAGG TTCAGGTGGA GGCGGCGGTT CAGGTGGAGG AGGAAGCGGC GGCGGAGGTT
CAGGCGGTGG AGGAAGCGGA GGCGGCGGAG GAGGAGGAAG CGGCGGCGGC GGGGGAGGAG GAAGATGCCC GATCGACACG
CTGAAGCTGG GGGTGTGCGC GAACGTGCTG AATGGGCTGA TAAACGTGCA GCTGGGGACG CCGCCGCGGC AGCCGTGTTG
CAGCCTCATC CAGGGCCTCG CCGACCTTGA GGCCGCCGTG TGCCTCTGCA CCGCCCTCCG CGCCAACATC CTTGGCATCA
ACCTCAACCT CCCCATCAAC CTCAGCCTCC TCGTCAACTA CTGCGGCCGC TCCGTCCCCT CCGGCTTCCA GTGCAGCAAC
TAATATAGCT GCTGCTCCAT TCTACTTCAC TGCTTGCTAC ACACAAGAAC GTACGAAGAA CGACCACCAG GCCACGTACA
ACTATATATC TATCTATGTC TAATTTGTTC CTTGTTCAAA TCATCATATG TATCTGCGTG CCTTAATTTC CTCCTTCATC
CCGTAAATTA ATGAGATATA TATGCATGCA TATGATTCAG TTCCACGACG TAATTAAAGC ATGCTTCATT CGTCTACTTG
TATATGTGTA TCTGCATAAT TGATTAATTA ATTTGTACTC GATGGATCTC ATCGTATATG C

Locus: Os03g0103300

Loading...

Locus: Os03g0103300

Loading...