Os03t0105600-01

Locus

Os03g0105600

Description

Tubulin beta-1 chain (Beta-1 tubulin).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

TUB2

CGSNL Gene Name

BETA-TUBULIN 2

Oryzabase Gene Symbol Synonym(s)

OsTUB2, TUBB2

Oryzabase Gene Name Synonym(s)

beta tubulin 2, Tubulin beta-2 chain, Beta-2-tubulin

Transcript Evidence

AK243618 (DDBJ, Best hit)

Protein Evidence

Q8H7U1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: GTP catabolic process (GO:0006184)

Biological Process: microtubule-based process (GO:0007017)

Biological Process: microtubule-based movement (GO:0007018)

Biological Process: protein polymerization (GO:0051258)

Cellular Component: microtubule (GO:0005874)

Cellular Component: protein complex (GO:0043234)

Molecular Function: GTPase activity (GO:0003924)

Molecular Function: structural molecule activity (GO:0005198)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Tubulin (IPR000217)

Beta tubulin (IPR002453)

Tubulin/FtsZ, GTPase domain (IPR003008)

Tubulin/FtsZ, C-terminal (IPR008280)

Beta tubulin, autoregulation binding site (IPR013838)

Tubulin, conserved site (IPR017975)

Tubulin/FtsZ, 2-layer sandwich domain (IPR018316)

Tubulin, C-terminal (IPR023123)

Full-length cDNA

J100085O15 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0105600-01)

Others

Oryzabase (2957)

KEGG (Os03t0105600-01)

Transcript

1696 bp

>Os03t0105600-01 Tubulin beta-1 chain (Beta-1 tubulin).
AACACTCCACTAACGCCTCCCGACGCCGCCGCCGCCTCCTCCTCTTGTTTCGCCACCGCC
GCCGCCGCCTACGAGGAAGAAGAAAGAAGAGGAAGGAGAAGATGAGGGAGATCCTCCACA
TCCAGGGTGGGCAATGCGGGAACCAGATCGGCGCCAAGTTCTGGGAGGTGGTGTGCGCGG
AGCACGGGATCGACGCCACCGGGCGCTACGACGGCGACTCCGACCTGCAGCTGGAGCGCG
TCAACGTGTACTACAATGAGGCCTCCTGCGGGCGCTTCGTCCCGCGCGCCGTGCTCATGG
ACCTGGAGCCGGGCACCATGGACTCCGTCCGCTCCGGCCCCTACGGCCACATCTTCCGCC
CGGACAACTTCGTCTTCGGCCAGTCCGGCGCCGGCAACAACTGGGCCAAGGGACACTACA
CCGAGGGCGCCGAGCTCATCGACGCCGTCCTCGACGTCGTACGAAAGGAGGCCGAGAACT
GCGACTGCCTCCAAGGGTTCCAGGTTTGCCACTCGCTTGGCGGCGGCACGGGGTCCGGCA
TGGGCACGCTCCTCATCTCCAAGATCCGGGAGGAGTACCCCGACCGGATGATGCTCACCT
TCTCCGTCTTCCCCTCGCCCAAGGTCTCCGACACCGTGGTGGAGCCCTACAACGCCACCC
TCTCCGTCCACCAGCTCGTCGAGAACGCCGACGAGTGCATGGTGCTCGACAACGAGGCCC
TCTACGACATCTGCTTCCGCACCCTCAAGCTCACCACCCCAAGCTTCGGCGACCTCAACC
ACCTCATCTCCGCCACCATGAGCGGCGTCACCTGCTGCCTCCGCTTCCCCGGCCAGCTCA
ACTCCGACCTCCGCAAGCTCGCCGTCAACCTCATCCCCTTCCCTCGCCTCCACTTCTTCA
TGGTCGGCTTCGCCCCGCTCACCTCCCGCGGCTCGCAGCAGTACCGCGCCCTCACCGTCC
CGGAGCTCACccagcagatgtgggacgccaagaacatgatgtgcgccgccgacccccgcc
acggccgctacctcaccgcctccgccatgttccgcggcaagatgtccaccaaggaggtgg
acgagcagatgctcaacgtccagaacaagaaCTCCTCCTACTTCGTCGAGTGGATCCCCA
ACAATGTCAAGTCCACCGTCTGCGACATCCCCCCCACCGGCCTCAAGATGGCCTCCACCT
TCATCGGCAACTCCACCTCCATCCAGGAGATGTTCCGCCGCGTCAGCGAGCAGTTCACCG
CCATGTTCCGCAGGAAGGCCTTCTTGCACTGGTACACGGGCGAGGGCATGGACGAGATGG
AGTTCACCGAGGCTGAGAGCAACATGAACGACCTCGTCTCCGAGTACCAGCAGTACCAGG
ACGCCACCGCCGACGACGAGGGTGAATACGAGGATGAGGAAGAAGAGGCTGATCTCCAGG
ACTAATTACTACTCTACTGCAATATCAATGTCCAATCTAATGGGGTTCGGTTCACTTCTT
GTGTTGCTTAGGCTATCTTCTCAAGTGTTGTCGTTCTTAATTATTACTCCTAGCTGCTAC
TCTACTCTACTTGATGTATTATTATTACTCAGCTTTGATTGATGATAGGCACAATACCCT
GTTGCCTTGTACTCGTAGGAGTATGTGCTGTTACTGTCTAACTGATCTGTATGAATTATC
ATCCTATTTTTGTTAA

CDS

1344 bp

>Os03t0105600-01 Tubulin beta-1 chain (Beta-1 tubulin).
ATGAGGGAGATCCTCCACATCCAGGGTGGGCAATGCGGGAACCAGATCGGCGCCAAGTTC
TGGGAGGTGGTGTGCGCGGAGCACGGGATCGACGCCACCGGGCGCTACGACGGCGACTCC
GACCTGCAGCTGGAGCGCGTCAACGTGTACTACAATGAGGCCTCCTGCGGGCGCTTCGTC
CCGCGCGCCGTGCTCATGGACCTGGAGCCGGGCACCATGGACTCCGTCCGCTCCGGCCCC
TACGGCCACATCTTCCGCCCGGACAACTTCGTCTTCGGCCAGTCCGGCGCCGGCAACAAC
TGGGCCAAGGGACACTACACCGAGGGCGCCGAGCTCATCGACGCCGTCCTCGACGTCGTA
CGAAAGGAGGCCGAGAACTGCGACTGCCTCCAAGGGTTCCAGGTTTGCCACTCGCTTGGC
GGCGGCACGGGGTCCGGCATGGGCACGCTCCTCATCTCCAAGATCCGGGAGGAGTACCCC
GACCGGATGATGCTCACCTTCTCCGTCTTCCCCTCGCCCAAGGTCTCCGACACCGTGGTG
GAGCCCTACAACGCCACCCTCTCCGTCCACCAGCTCGTCGAGAACGCCGACGAGTGCATG
GTGCTCGACAACGAGGCCCTCTACGACATCTGCTTCCGCACCCTCAAGCTCACCACCCCA
AGCTTCGGCGACCTCAACCACCTCATCTCCGCCACCATGAGCGGCGTCACCTGCTGCCTC
CGCTTCCCCGGCCAGCTCAACTCCGACCTCCGCAAGCTCGCCGTCAACCTCATCCCCTTC
CCTCGCCTCCACTTCTTCATGGTCGGCTTCGCCCCGCTCACCTCCCGCGGCTCGCAGCAG
TACCGCGCCCTCACCGTCCCGGAGCTCACccagcagatgtgggacgccaagaacatgatg
tgcgccgccgacccccgccacggccgctacctcaccgcctccgccatgttccgcggcaag
atgtccaccaaggaggtggacgagcagatgctcaacgtccagaacaagaaCTCCTCCTAC
TTCGTCGAGTGGATCCCCAACAATGTCAAGTCCACCGTCTGCGACATCCCCCCCACCGGC
CTCAAGATGGCCTCCACCTTCATCGGCAACTCCACCTCCATCCAGGAGATGTTCCGCCGC
GTCAGCGAGCAGTTCACCGCCATGTTCCGCAGGAAGGCCTTCTTGCACTGGTACACGGGC
GAGGGCATGGACGAGATGGAGTTCACCGAGGCTGAGAGCAACATGAACGACCTCGTCTCC
GAGTACCAGCAGTACCAGGACGCCACCGCCGACGACGAGGGTGAATACGAGGATGAGGAA
GAAGAGGCTGATCTCCAGGACTAA

Protein

448 aa

>Os03t0105600-01 Tubulin beta-1 chain (Beta-1 tubulin).
MREILHIQGGQCGNQIGAKFWEVVCAEHGIDATGRYDGDSDLQLERVNVYYNEASCGRFV
PRAVLMDLEPGTMDSVRSGPYGHIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVV
RKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVV
EPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLNHLISATMSGVTCCL
RFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMM
CAADPRHGRYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTG
LKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADDEGEYEDEEEEADLQD*

5'UTR

chr03:339986..340086 (+ strand) : 101 bp

CDS

chr03:340087..340480 (+ strand) : 394 bp

chr03:340557..341506 (+ strand) : 950 bp

3'UTR

chr03:341507..341757 (+ strand) : 251 bp

FASTA

>Os03t0105600-01 class=Sequence position=chr03:339986..341757 (+ strand)
AACACTCCAC TAACGCCTCC CGACGCCGCC GCCGCCTCCT CCTCTTGTTT CGCCACCGCC GCCGCCGCCT ACGAGGAAGA
AGAAAGAAGA GGAAGGAGAA GATGAGGGAG ATCCTCCACA TCCAGGGTGG GCAATGCGGG AACCAGATCG GCGCCAAGTT
CTGGGAGGTG GTGTGCGCGG AGCACGGGAT CGACGCCACC GGGCGCTACG ACGGCGACTC CGACCTGCAG CTGGAGCGCG
TCAACGTGTA CTACAATGAG GCCTCCTGCG GGCGCTTCGT CCCGCGCGCC GTGCTCATGG ACCTGGAGCC GGGCACCATG
GACTCCGTCC GCTCCGGCCC CTACGGCCAC ATCTTCCGCC CGGACAACTT CGTCTTCGGC CAGTCCGGCG CCGGCAACAA
CTGGGCCAAG GGACACTACA CCGAGGGCGC CGAGCTCATC GACGCCGTCC TCGACGTCGT ACGAAAGGAG GCCGAGAACT
GCGACTGCCT CCAAGGTAAC TAGTACCCTA ACTATCTCAG ATCTGCCTCT CCTCAAATCA AATCTGAGTT CAAATGCTGC
TGCTGCTGCA GGGTTCCAGG TTTGCCACTC GCTTGGCGGC GGCACGGGGT CCGGCATGGG CACGCTCCTC ATCTCCAAGA
TCCGGGAGGA GTACCCCGAC CGGATGATGC TCACCTTCTC CGTCTTCCCC TCGCCCAAGG TCTCCGACAC CGTGGTGGAG
CCCTACAACG CCACCCTCTC CGTCCACCAG CTCGTCGAGA ACGCCGACGA GTGCATGGTG CTCGACAACG AGGCCCTCTA
CGACATCTGC TTCCGCACCC TCAAGCTCAC CACCCCAAGC TTCGGCGACC TCAACCACCT CATCTCCGCC ACCATGAGCG
GCGTCACCTG CTGCCTCCGC TTCCCCGGCC AGCTCAACTC CGACCTCCGC AAGCTCGCCG TCAACCTCAT CCCCTTCCCT
CGCCTCCACT TCTTCATGGT CGGCTTCGCC CCGCTCACCT CCCGCGGCTC GCAGCAGTAC CGCGCCCTCA CCGTCCCGGA
GCTCACccag cagatgtggg acgccaagaa catgatgtgc gccgccgacc cccgccacgg ccgctacctc accgcctccg
ccatgttccg cggcaagatg tccaccaagg aggtggacga gcagatgctc aacgtccaga acaagaaCTC CTCCTACTTC
GTCGAGTGGA TCCCCAACAA TGTCAAGTCC ACCGTCTGCG ACATCCCCCC CACCGGCCTC AAGATGGCCT CCACCTTCAT
CGGCAACTCC ACCTCCATCC AGGAGATGTT CCGCCGCGTC AGCGAGCAGT TCACCGCCAT GTTCCGCAGG AAGGCCTTCT
TGCACTGGTA CACGGGCGAG GGCATGGACG AGATGGAGTT CACCGAGGCT GAGAGCAACA TGAACGACCT CGTCTCCGAG
TACCAGCAGT ACCAGGACGC CACCGCCGAC GACGAGGGTG AATACGAGGA TGAGGAAGAA GAGGCTGATC TCCAGGACTA
ATTACTACTC TACTGCAATA TCAATGTCCA ATCTAATGGG GTTCGGTTCA CTTCTTGTGT TGCTTAGGCT ATCTTCTCAA
GTGTTGTCGT TCTTAATTAT TACTCCTAGC TGCTACTCTA CTCTACTTGA TGTATTATTA TTACTCAGCT TTGATTGATG
ATAGGCACAA TACCCTGTTG CCTTGTACTC GTAGGAGTAT GTGCTGTTAC TGTCTAACTG ATCTGTATGA ATTATCATCC
TATTTTTGTT AA

Locus: Os03g0105600

Loading...

Locus: Os03g0105600

Loading...