Os03t0109000-01

Locus

Os03g0109000

Description

Similar to NAC domain protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC55

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 55

Oryzabase Gene Symbol Synonym(s)

ONAC055, ONAC55

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 055, NAC domain-containing protein 55

Transcript Evidence

AK070416 (DDBJ, Best hit)

Protein Evidence

D8UUZ6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

J023051N16 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0109000-01)

RiceXPro (AK070416)

Others

Oryzabase (11488)

KEGG (Os03t0109000-01)

Transcript

1077 bp

>Os03t0109000-01 Similar to NAC domain protein.
TGCACGTAGTGTTCGATTAATTCTTGAGCTCATATATTACTTATTCATCCAAATAGTATT
GGTAGCTTGTTGATCGAAGAATTAATCCATGGATGGATTGATCAGTGATGATAGTATGAT
GATGGGTGGTGAGGTGAGGGCGATCgagtcgaggctgcctccgggtttcaggttccatcc
cagcgacgaggagctagtcggctactaccttcggaacaagcagcagcagcagcagcagca
gacggcggccacctccatgctcgtcgaggttgacctccatgcctgcgagccatgggacct
accagaggtggcgaaggttggttcggatgagtggtatttcttcagctggagggagaggaa
gtacgcgacggggtggcgcaggaacagagcgagcaagcaagggtactggaaggccaccgg
gaaagacaagcccatccttcatccgacggtggccggcgccaggaagacgttggttttcta
ctccggtcgcgcccccaacggccgcaagaccgcctgggtcatgcacgagttccgcctcct
ccatcatcatcatcatccaaacccaaatATTCAGAATATGCAGCAGCAGGAGGGGGATGA
CTGGGTGCTGTGCAGGGTGTTCCGTAAGGGGAACAACAGCAATGGACAACCTCTAGCCAC
TTCTTCGCCACCTGCTCATCACCTGGTGGAGTCACTCATCAGCTCACCTGCACCAACTAT
CATGAGCGATCACGATCGGCTCTTCACCATCCAGCTGCCGCATCACCAACATTGTGATGA
GCAGTACTTTTTCTTAGATGACGATGAACAGCACCAGCAGCAGCTGCTAGATCTTTCAGT
GCTCCAAGCTCCAACCTCGTTCGAGTCTGAGCAAGCTCCAGGCCACGGTGGCATGGAGAT
TAATATCGCAGAGATGGAGAGCTTCGACACGACCTGTGCTGCGCTGCAAGACGCGAGCGA
TTACTGCATGCAGCTCTATTAATTAATTCAATGGATGGATGAATCACACGTATATATACG
CATAGCCTTAAATTAATTAATGTGTATCATCAGCTTAATTAATTGCGCACTTGGCTT

CDS

894 bp

>Os03t0109000-01 Similar to NAC domain protein.
ATGGATGGATTGATCAGTGATGATAGTATGATGATGGGTGGTGAGGTGAGGGCGATCgag
tcgaggctgcctccgggtttcaggttccatcccagcgacgaggagctagtcggctactac
cttcggaacaagcagcagcagcagcagcagcagacggcggccacctccatgctcgtcgag
gttgacctccatgcctgcgagccatgggacctaccagaggtggcgaaggttggttcggat
gagtggtatttcttcagctggagggagaggaagtacgcgacggggtggcgcaggaacaga
gcgagcaagcaagggtactggaaggccaccgggaaagacaagcccatccttcatccgacg
gtggccggcgccaggaagacgttggttttctactccggtcgcgcccccaacggccgcaag
accgcctgggtcatgcacgagttccgcctcctccatcatcatcatcatccaaacccaaat
ATTCAGAATATGCAGCAGCAGGAGGGGGATGACTGGGTGCTGTGCAGGGTGTTCCGTAAG
GGGAACAACAGCAATGGACAACCTCTAGCCACTTCTTCGCCACCTGCTCATCACCTGGTG
GAGTCACTCATCAGCTCACCTGCACCAACTATCATGAGCGATCACGATCGGCTCTTCACC
ATCCAGCTGCCGCATCACCAACATTGTGATGAGCAGTACTTTTTCTTAGATGACGATGAA
CAGCACCAGCAGCAGCTGCTAGATCTTTCAGTGCTCCAAGCTCCAACCTCGTTCGAGTCT
GAGCAAGCTCCAGGCCACGGTGGCATGGAGATTAATATCGCAGAGATGGAGAGCTTCGAC
ACGACCTGTGCTGCGCTGCAAGACGCGAGCGATTACTGCATGCAGCTCTATTAA

Protein

298 aa

>Os03t0109000-01 Similar to NAC domain protein.
MDGLISDDSMMMGGEVRAIESRLPPGFRFHPSDEELVGYYLRNKQQQQQQQTAATSMLVE
VDLHACEPWDLPEVAKVGSDEWYFFSWRERKYATGWRRNRASKQGYWKATGKDKPILHPT
VAGARKTLVFYSGRAPNGRKTAWVMHEFRLLHHHHHPNPNIQNMQQQEGDDWVLCRVFRK
GNNSNGQPLATSSPPAHHLVESLISSPAPTIMSDHDRLFTIQLPHHQHCDEQYFFLDDDE
QHQQQLLDLSVLQAPTSFESEQAPGHGGMEINIAEMESFDTTCAALQDASDYCMQLY*

5'UTR

chr03:524008..524095 (+ strand) : 88 bp

CDS

chr03:524096..524312 (+ strand) : 217 bp

chr03:524420..524682 (+ strand) : 263 bp

chr03:524770..525183 (+ strand) : 414 bp

3'UTR

chr03:525184..525278 (+ strand) : 95 bp

FASTA

>Os03t0109000-01 class=Sequence position=chr03:524008..525278 (+ strand)
TGCACGTAGT GTTCGATTAA TTCTTGAGCT CATATATTAC TTATTCATCC AAATAGTATT GGTAGCTTGT TGATCGAAGA
ATTAATCCAT GGATGGATTG ATCAGTGATG ATAGTATGAT GATGGGTGGT GAGGTGAGGG CGATCgagtc gaggctgcct
ccgggtttca ggttccatcc cagcgacgag gagctagtcg gctactacct tcggaacaag cagcagcagc agcagcagca
gacggcggcc acctccatgc tcgtcgaggt tgacctccat gcctgcgagc catgggacct accaggtaat ataatACTTA
CCAGTTAATC TACTACGTAC AGTAGTAGAC TAATTAATTA ATTAATTAAT TGATAAACTT TGTGAAATTG GCATATACTC
Ctatatgtgt agaggtggcg aaggttggtt cggatgagtg gtatttcttc agctggaggg agaggaagta cgcgacgggg
tggcgcagga acagagcgag caagcaaggg tactggaagg ccaccgggaa agacaagccc atccttcatc cgacggtggc
cggcgccagg aagacgttgg ttttctactc cggtcgcgcc cccaacggcc gcaagaccgc ctgggtcatg cacgagttcc
gcctcctcca tcatcatcat catccaaacc caaatgtaaT TACTCCTAAT TATATTATAT ATATATGCAT TATATATGTA
GCTAATTAAT CTGAATGTAT GTACACTGAT CTCTGCATGC AGATTCAGAA TATGCAGCAG CAGGAGGGGG ATGACTGGGT
GCTGTGCAGG GTGTTCCGTA AGGGGAACAA CAGCAATGGA CAACCTCTAG CCACTTCTTC GCCACCTGCT CATCACCTGG
TGGAGTCACT CATCAGCTCA CCTGCACCAA CTATCATGAG CGATCACGAT CGGCTCTTCA CCATCCAGCT GCCGCATCAC
CAACATTGTG ATGAGCAGTA CTTTTTCTTA GATGACGATG AACAGCACCA GCAGCAGCTG CTAGATCTTT CAGTGCTCCA
AGCTCCAACC TCGTTCGAGT CTGAGCAAGC TCCAGGCCAC GGTGGCATGG AGATTAATAT CGCAGAGATG GAGAGCTTCG
ACACGACCTG TGCTGCGCTG CAAGACGCGA GCGATTACTG CATGCAGCTC TATTAATTAA TTCAATGGAT GGATGAATCA
CACGTATATA TACGCATAGC CTTAAATTAA TTAATGTGTA TCATCAGCTT AATTAATTGC GCACTTGGCT T

Locus: Os03g0109000

Loading...

Locus: Os03g0109000

Loading...