Os03t0111300-01

Locus

Os03g0111300

Description

Nonspecific lipid-transfer protein 2 (nsLTP2) (7 kDa lipid transfer protein).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

LTP2

CGSNL Gene Name

LIPID TRANSFER PROTEIN 2

Oryzabase Gene Symbol Synonym(s)

nsLTP2, OsLTP2.3, Ltp2, OsLTP2, RLTP2, OsLtpII.3

Oryzabase Gene Name Synonym(s)

non-specific lipid-transfer protein 2, type-2 lipid transfer protein, Nonspecific Lipid Transfer Protein-2, lipid transfer protein-2

Transcript Evidence

AK062506 (DDBJ, Best hit)

Protein Evidence

Q10ST8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Functional domain (InterPro)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Full-length cDNA

001-104-B07 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0111300-01)

RiceXPro (AK062506)

Others

Oryzabase (9011)

KEGG (Os03t0111300-01)

Transcript

476 bp

>Os03t0111300-01 Nonspecific lipid-transfer protein 2 (nsLTP2) (7 kDa lipid transfer protein).
GTACCTCGCAGCACCAAGCTAGCTAGCTTCGATCAGTAGCTGGAGGATGATGAGGAAGTT
GGCGGTGTTGGTGTTGGCGGTGGCGATGGTGGCGGCGTGCGGCGGCGGCGTCGTGGGTGT
AGCGGGGGCCGGTTGCAACGCTGGGCAGCTGACGGTGTGCACGGGGGCGATCGCGGGCGG
GGCGCGGCCGACGGCGGCGTGCTGCTCCAGCCTGCGGGCGCAGCAGGGCTGCTTCTGCCA
GTTCGCCAAGGACCCGCGCTACGGGCGCTACGTCAACAGCCCCAACGCCCGCAAGGCCGT
CTCCTCCTGCGGCATCGCCCTCCCCACCTGCCACTGATCCATCCATCCATCGTCTCCTAC
TCTTTTATTTTGTGATGTGGTGTACGTGTTCGTAGTATTGTCTTGGCGTCATCTCGTCAC
GACGCGTATATGCATGCGCAGTGCGGCTTTTGAATAAAAGGGGATCGACCGATGTT

CDS

291 bp

>Os03t0111300-01 Nonspecific lipid-transfer protein 2 (nsLTP2) (7 kDa lipid transfer protein).
ATGATGAGGAAGTTGGCGGTGTTGGTGTTGGCGGTGGCGATGGTGGCGGCGTGCGGCGGC
GGCGTCGTGGGTGTAGCGGGGGCCGGTTGCAACGCTGGGCAGCTGACGGTGTGCACGGGG
GCGATCGCGGGCGGGGCGCGGCCGACGGCGGCGTGCTGCTCCAGCCTGCGGGCGCAGCAG
GGCTGCTTCTGCCAGTTCGCCAAGGACCCGCGCTACGGGCGCTACGTCAACAGCCCCAAC
GCCCGCAAGGCCGTCTCCTCCTGCGGCATCGCCCTCCCCACCTGCCACTGA

Protein

97 aa

>Os03t0111300-01 Nonspecific lipid-transfer protein 2 (nsLTP2) (7 kDa lipid transfer protein).
MMRKLAVLVLAVAMVAACGGGVVGVAGAGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQ
GCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH*

5'UTR

chr03:652753..652798 (- strand) : 46 bp

CDS

chr03:652462..652752 (- strand) : 291 bp

3'UTR

chr03:652323..652461 (- strand) : 139 bp

FASTA

>Os03t0111300-01 class=Sequence position=chr03:652323..652798 (- strand)
GTACCTCGCA GCACCAAGCT AGCTAGCTTC GATCAGTAGC TGGAGGATGA TGAGGAAGTT GGCGGTGTTG GTGTTGGCGG
TGGCGATGGT GGCGGCGTGC GGCGGCGGCG TCGTGGGTGT AGCGGGGGCC GGTTGCAACG CTGGGCAGCT GACGGTGTGC
ACGGGGGCGA TCGCGGGCGG GGCGCGGCCG ACGGCGGCGT GCTGCTCCAG CCTGCGGGCG CAGCAGGGCT GCTTCTGCCA
GTTCGCCAAG GACCCGCGCT ACGGGCGCTA CGTCAACAGC CCCAACGCCC GCAAGGCCGT CTCCTCCTGC GGCATCGCCC
TCCCCACCTG CCACTGATCC ATCCATCCAT CGTCTCCTAC TCTTTTATTT TGTGATGTGG TGTACGTGTT CGTAGTATTG
TCTTGGCGTC ATCTCGTCAC GACGCGTATA TGCATGCGCA GTGCGGCTTT TGAATAAAAG GGGATCGACC GATGTT

Locus: Os03g0111300

Loading...

Locus: Os03g0111300

Loading...