Os03t0112700-01

Locus

Os03g0112700

Description

Zinc finger CCCH domain-containing protein

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

EHD4

CGSNL Gene Name

EARLY HEADING DATE 4

Oryzabase Gene Symbol Synonym(s)

OsC3H20, C3H20, Ehd4, DLN73, DLN73a, DLN73b, OsDLN73, OsDLN73a, OsDLN73b

Oryzabase Gene Name Synonym(s)

Zinc finger CCCH domain-containing protein 20, Early heading date 4, DLN repressor 73, DLN motif protein 73

Transcript Evidence

AK112095

Protein Evidence

Q0DVU4

Literature

PMID: 18221561

Note

Manual Curation

November 18, 2015

Gene Ontology (GO)

Molecular Function: metal ion binding (GO:0046872)

Functional domain (InterPro)

Zinc finger, CCCH-type (IPR000571)

Full-length cDNA

002-107-G01 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0112700-01)

RiceXPro (AK112095)

Others

Oryzabase (8584)

KEGG (Os03t0112700-01)

Transcript

2349 bp

>Os03t0112700-01 Zinc finger CCCH domain-containing protein
TTGAAGACAGAGGTTCAAGCTCACCCTCTGGTATGCTGAGTCTCTCGGAAAGAGCACCAA
TCTGCAGTCCACAGTCAGCTCCTTCTGCGTCTGCTTCTGATACATGCAAGATGGAGGAGA
ACATGAATCAACAAAAAACACTTGAAGCTGATATATCAAACACGTCAGTTAATCAGTCTC
CACAGTCTAAGATTCTCCCTGAATCTTCTCCTGATAACCAAGATGCTGAACATGAATATC
GTAGTCCACCTCCAATATCTGAGAGTAAAGAGTTATCCCCACAGTCAAGGACTACCCCTG
GATCTTCTCCTGATAACCAAGATACTGAACGTGAATATCCTAGCCCGCCTCCAATATCTG
GGAGTAAAGAGATATCCCCACAGTCAAGGACTATCCTTGAATCTTCTCCTGATAACCAAG
ATAATGGACATGAATATCCTAGTCCACCTCCGATACCGGAGAGTATAGAGCTATCTCCGC
ATTCTAAGGCTCTCCCTGAATCTTCTCCTGATAACCAAGATATTGAACCTGAATGCCCTA
GTCCACCTCAAATACCCGAGAGTAAAGAGCTATCTCGGCAGTCTAAGATTCTCCCTGAAT
CATCTCCTGGTAACCAAGATATTGAACCTGAATGCCCTAGTCCACCGCAAATACCTGAGA
GTAAAGAGCTATCTCAGCAGTCTAAGATTCTCCCTGAATCCTCTCCTGATAACCACGATA
TTAAATGTGAATATTCCAGTCCAACTCCGATACCCGAGAGTAAAGAGCTATCTCTGCAGT
CTAAGATTCTCCCTGAATCTTCTTCTGATAACCAAGATATTAAGTGTGAAGATCCTAGCC
CAACTCCGATATCTAAGAGTAAAGAGGTGTCTCCGCAATCTAAGATTCTCTCTGAATCTT
ATCTTGATAACCAAGATGTTGAACGTGAGTGTCCTAGTTCCATTCTGATAACTGAGAGTA
AAGAGCTTGCTGTGGACCTCCCTGGATCAATATCATTAGCACCTGAAAAAACAGCTTCTA
CTGATGTAGGTGAAAACTCTTCACTTGCTTTTATTTTTCCAAAATCTACTCTGGCTGGGG
ATGATGCTTTGAAATCAGTATTTGATATGGCAAAGGCGCATTTAGAATGTGAAGATTCAA
AGGTTAAAGAAGAACTGTATGTTGAATCAACTGTTGTTATAAGAGATGACATGGTTGTTA
ATCCTGCCTCTGGAGTTGAGTCCATAGACATGTCTGAAAATCTCTTGGAATCTTTGATGG
AGCAAAGTTGTGGAACTTTTTACATGGATGGTACAACAGCCTTAGAAGGTTTTCTGTCTG
GTTCAACGAAGGAAGAACCGCAATGTTCTAGCCCCATTGCTTTATCCACATGCTCTAGCC
CCATTGCATTATCCCCTTGGGGTGAACATGGCTACTATCAAGGAGATTCTGTTGGTTCTT
CTTTATGGGGTGTCCAGGACGATGATCCAATCGGTAATATTTGGCCATTATCCTCACAAG
CACCGGCTCTCCAGTATTCATCTGGTAGCACTGCTCATTTTATTGATGAAGCAACTGTCA
CCCATGGAAATAATGGAGTTGTTCTAAGTAGCACGCCAGGGGAGGAGGTGGGTTTACCAA
ACTCAGGTGTTTGCACAGATTGGGGATTGGTTGAGCAGGTGAATCCAGAAACAAATGATG
CATCGGTATCAATGATAGACAAGAACTCAGGATTAGTAGATTCTCAACCATCAGCAAATG
ATGGCTCAGATGTGGGTACTGCACGGAACACTAACCATAATACTAACTTGTCCCTCAACC
ATGAAACAGCGGTACCCTTGAGTAGAAGTTCTGGAGAAGCATCAAGAAAACACGGATTTA
TTACTGACTTGAATGTTGCTACTTCAGAGGAGGCGTTAGGGAACACCAAGAACTGGAATC
CATATGCTGGTAATGCTAATCGGGGCAGCCAGCGGAATCATCACCGTGACAGGTACTCTC
AAATAAGCGAATCTTGGCTTCTTAGCTCAAACTACTCTAGGAGTAGGTCTGATGGATTTG
GCACTGGTGGATCGTCGAGATCAACCCCAAGGGGACAAACTCAGAGGGGGATATGTAAAT
TTCATGAGAATGGCTACTGCAGGAAGGGTGCATCTTGTAACTACCTGCACCCCTGATCTC
TGCAATAGATAACGAGGGTTTGCATTCTTTGCCCATATCTTTTGACTTTTTTGTATAGCC
TAATTACAGTGGTAGTCAACATAGAGCCTACACAACCTTTTCTTGGTTTCATTCAACCGT
AGCAAGGACGGAGTATATGTCTAGCTCTAGCATAGGAGGATGACTGAATGTACTGCCCAA
GCAGATTCC

CDS

2124 bp

>Os03t0112700-01 Zinc finger CCCH domain-containing protein
ATGCTGAGTCTCTCGGAAAGAGCACCAATCTGCAGTCCACAGTCAGCTCCTTCTGCGTCT
GCTTCTGATACATGCAAGATGGAGGAGAACATGAATCAACAAAAAACACTTGAAGCTGAT
ATATCAAACACGTCAGTTAATCAGTCTCCACAGTCTAAGATTCTCCCTGAATCTTCTCCT
GATAACCAAGATGCTGAACATGAATATCGTAGTCCACCTCCAATATCTGAGAGTAAAGAG
TTATCCCCACAGTCAAGGACTACCCCTGGATCTTCTCCTGATAACCAAGATACTGAACGT
GAATATCCTAGCCCGCCTCCAATATCTGGGAGTAAAGAGATATCCCCACAGTCAAGGACT
ATCCTTGAATCTTCTCCTGATAACCAAGATAATGGACATGAATATCCTAGTCCACCTCCG
ATACCGGAGAGTATAGAGCTATCTCCGCATTCTAAGGCTCTCCCTGAATCTTCTCCTGAT
AACCAAGATATTGAACCTGAATGCCCTAGTCCACCTCAAATACCCGAGAGTAAAGAGCTA
TCTCGGCAGTCTAAGATTCTCCCTGAATCATCTCCTGGTAACCAAGATATTGAACCTGAA
TGCCCTAGTCCACCGCAAATACCTGAGAGTAAAGAGCTATCTCAGCAGTCTAAGATTCTC
CCTGAATCCTCTCCTGATAACCACGATATTAAATGTGAATATTCCAGTCCAACTCCGATA
CCCGAGAGTAAAGAGCTATCTCTGCAGTCTAAGATTCTCCCTGAATCTTCTTCTGATAAC
CAAGATATTAAGTGTGAAGATCCTAGCCCAACTCCGATATCTAAGAGTAAAGAGGTGTCT
CCGCAATCTAAGATTCTCTCTGAATCTTATCTTGATAACCAAGATGTTGAACGTGAGTGT
CCTAGTTCCATTCTGATAACTGAGAGTAAAGAGCTTGCTGTGGACCTCCCTGGATCAATA
TCATTAGCACCTGAAAAAACAGCTTCTACTGATGTAGGTGAAAACTCTTCACTTGCTTTT
ATTTTTCCAAAATCTACTCTGGCTGGGGATGATGCTTTGAAATCAGTATTTGATATGGCA
AAGGCGCATTTAGAATGTGAAGATTCAAAGGTTAAAGAAGAACTGTATGTTGAATCAACT
GTTGTTATAAGAGATGACATGGTTGTTAATCCTGCCTCTGGAGTTGAGTCCATAGACATG
TCTGAAAATCTCTTGGAATCTTTGATGGAGCAAAGTTGTGGAACTTTTTACATGGATGGT
ACAACAGCCTTAGAAGGTTTTCTGTCTGGTTCAACGAAGGAAGAACCGCAATGTTCTAGC
CCCATTGCTTTATCCACATGCTCTAGCCCCATTGCATTATCCCCTTGGGGTGAACATGGC
TACTATCAAGGAGATTCTGTTGGTTCTTCTTTATGGGGTGTCCAGGACGATGATCCAATC
GGTAATATTTGGCCATTATCCTCACAAGCACCGGCTCTCCAGTATTCATCTGGTAGCACT
GCTCATTTTATTGATGAAGCAACTGTCACCCATGGAAATAATGGAGTTGTTCTAAGTAGC
ACGCCAGGGGAGGAGGTGGGTTTACCAAACTCAGGTGTTTGCACAGATTGGGGATTGGTT
GAGCAGGTGAATCCAGAAACAAATGATGCATCGGTATCAATGATAGACAAGAACTCAGGA
TTAGTAGATTCTCAACCATCAGCAAATGATGGCTCAGATGTGGGTACTGCACGGAACACT
AACCATAATACTAACTTGTCCCTCAACCATGAAACAGCGGTACCCTTGAGTAGAAGTTCT
GGAGAAGCATCAAGAAAACACGGATTTATTACTGACTTGAATGTTGCTACTTCAGAGGAG
GCGTTAGGGAACACCAAGAACTGGAATCCATATGCTGGTAATGCTAATCGGGGCAGCCAG
CGGAATCATCACCGTGACAGGTACTCTCAAATAAGCGAATCTTGGCTTCTTAGCTCAAAC
TACTCTAGGAGTAGGTCTGATGGATTTGGCACTGGTGGATCGTCGAGATCAACCCCAAGG
GGACAAACTCAGAGGGGGATATGTAAATTTCATGAGAATGGCTACTGCAGGAAGGGTGCA
TCTTGTAACTACCTGCACCCCTGA

Protein

708 aa

>Os03t0112700-01 Zinc finger CCCH domain-containing protein
MLSLSERAPICSPQSAPSASASDTCKMEENMNQQKTLEADISNTSVNQSPQSKILPESSP
DNQDAEHEYRSPPPISESKELSPQSRTTPGSSPDNQDTEREYPSPPPISGSKEISPQSRT
ILESSPDNQDNGHEYPSPPPIPESIELSPHSKALPESSPDNQDIEPECPSPPQIPESKEL
SRQSKILPESSPGNQDIEPECPSPPQIPESKELSQQSKILPESSPDNHDIKCEYSSPTPI
PESKELSLQSKILPESSSDNQDIKCEDPSPTPISKSKEVSPQSKILSESYLDNQDVEREC
PSSILITESKELAVDLPGSISLAPEKTASTDVGENSSLAFIFPKSTLAGDDALKSVFDMA
KAHLECEDSKVKEELYVESTVVIRDDMVVNPASGVESIDMSENLLESLMEQSCGTFYMDG
TTALEGFLSGSTKEEPQCSSPIALSTCSSPIALSPWGEHGYYQGDSVGSSLWGVQDDDPI
GNIWPLSSQAPALQYSSGSTAHFIDEATVTHGNNGVVLSSTPGEEVGLPNSGVCTDWGLV
EQVNPETNDASVSMIDKNSGLVDSQPSANDGSDVGTARNTNHNTNLSLNHETAVPLSRSS
GEASRKHGFITDLNVATSEEALGNTKNWNPYAGNANRGSQRNHHRDRYSQISESWLLSSN
YSRSRSDGFGTGGSSRSTPRGQTQRGICKFHENGYCRKGASCNYLHP*

5'UTR

chr03:717839..717870 (+ strand) : 32 bp

CDS

chr03:717871..719362 (+ strand) : 1492 bp

chr03:719465..719598 (+ strand) : 134 bp

chr03:719684..720181 (+ strand) : 498 bp

3'UTR

chr03:720182..720374 (+ strand) : 193 bp

FASTA

>Os03t0112700-01 class=Sequence position=chr03:717839..720374 (+ strand)
TTGAAGACAG AGGTTCAAGC TCACCCTCTG GTATGCTGAG TCTCTCGGAA AGAGCACCAA TCTGCAGTCC ACAGTCAGCT
CCTTCTGCGT CTGCTTCTGA TACATGCAAG ATGGAGGAGA ACATGAATCA ACAAAAAACA CTTGAAGCTG ATATATCAAA
CACGTCAGTT AATCAGTCTC CACAGTCTAA GATTCTCCCT GAATCTTCTC CTGATAACCA AGATGCTGAA CATGAATATC
GTAGTCCACC TCCAATATCT GAGAGTAAAG AGTTATCCCC ACAGTCAAGG ACTACCCCTG GATCTTCTCC TGATAACCAA
GATACTGAAC GTGAATATCC TAGCCCGCCT CCAATATCTG GGAGTAAAGA GATATCCCCA CAGTCAAGGA CTATCCTTGA
ATCTTCTCCT GATAACCAAG ATAATGGACA TGAATATCCT AGTCCACCTC CGATACCGGA GAGTATAGAG CTATCTCCGC
ATTCTAAGGC TCTCCCTGAA TCTTCTCCTG ATAACCAAGA TATTGAACCT GAATGCCCTA GTCCACCTCA AATACCCGAG
AGTAAAGAGC TATCTCGGCA GTCTAAGATT CTCCCTGAAT CATCTCCTGG TAACCAAGAT ATTGAACCTG AATGCCCTAG
TCCACCGCAA ATACCTGAGA GTAAAGAGCT ATCTCAGCAG TCTAAGATTC TCCCTGAATC CTCTCCTGAT AACCACGATA
TTAAATGTGA ATATTCCAGT CCAACTCCGA TACCCGAGAG TAAAGAGCTA TCTCTGCAGT CTAAGATTCT CCCTGAATCT
TCTTCTGATA ACCAAGATAT TAAGTGTGAA GATCCTAGCC CAACTCCGAT ATCTAAGAGT AAAGAGGTGT CTCCGCAATC
TAAGATTCTC TCTGAATCTT ATCTTGATAA CCAAGATGTT GAACGTGAGT GTCCTAGTTC CATTCTGATA ACTGAGAGTA
AAGAGCTTGC TGTGGACCTC CCTGGATCAA TATCATTAGC ACCTGAAAAA ACAGCTTCTA CTGATGTAGG TGAAAACTCT
TCACTTGCTT TTATTTTTCC AAAATCTACT CTGGCTGGGG ATGATGCTTT GAAATCAGTA TTTGATATGG CAAAGGCGCA
TTTAGAATGT GAAGATTCAA AGGTTAAAGA AGAACTGTAT GTTGAATCAA CTGTTGTTAT AAGAGATGAC ATGGTTGTTA
ATCCTGCCTC TGGAGTTGAG TCCATAGACA TGTCTGAAAA TCTCTTGGAA TCTTTGATGG AGCAAAGTTG TGGAACTTTT
TACATGGATG GTACAACAGC CTTAGAAGGT TTTCTGTCTG GTTCAACGAA GGAAGAACCG CAATGTTCTA GCCCCATTGC
TTTATCCACA TGCTCTAGCC CCATTGCATT ATCCCCTTGG GGTGAACATG GCTACTATCA AGGAGATTCT GTTGGTTCTT
CTTTATGGGG TGTCCAGGAC GATGATCCAA TCGGTAATAT TTGGCCATTA TCCTCACAAG CACCGGCTCT CCAGTATTCA
TCTGGTTAGT CTGTTGATGT TTAGCATGCA TCCATTAGTC CTAAACAGTT TGTGGTGTTT AGCTTACACC TACTAATTTT
GCATTGTAAA ATTCTCTCTC CAGCAGGTAG CACTGCTCAT TTTATTGATG AAGCAACTGT CACCCATGGA AATAATGGAG
TTGTTCTAAG TAGCACGCCA GGGGAGGAGG TGGGTTTACC AAACTCAGGT GTTTGCACAG ATTGGGGATT GGTTGAGCAG
GTAATGATAT TCCAACATCA TGTCAGCCTT TGACATTTGC TTTGTGTATG ACATTCCATT TGACATTGGG TTCTCACTAC
AATAGGTGAA TCCAGAAACA AATGATGCAT CGGTATCAAT GATAGACAAG AACTCAGGAT TAGTAGATTC TCAACCATCA
GCAAATGATG GCTCAGATGT GGGTACTGCA CGGAACACTA ACCATAATAC TAACTTGTCC CTCAACCATG AAACAGCGGT
ACCCTTGAGT AGAAGTTCTG GAGAAGCATC AAGAAAACAC GGATTTATTA CTGACTTGAA TGTTGCTACT TCAGAGGAGG
CGTTAGGGAA CACCAAGAAC TGGAATCCAT ATGCTGGTAA TGCTAATCGG GGCAGCCAGC GGAATCATCA CCGTGACAGG
TACTCTCAAA TAAGCGAATC TTGGCTTCTT AGCTCAAACT ACTCTAGGAG TAGGTCTGAT GGATTTGGCA CTGGTGGATC
GTCGAGATCA ACCCCAAGGG GACAAACTCA GAGGGGGATA TGTAAATTTC ATGAGAATGG CTACTGCAGG AAGGGTGCAT
CTTGTAACTA CCTGCACCCC TGATCTCTGC AATAGATAAC GAGGGTTTGC ATTCTTTGCC CATATCTTTT GACTTTTTTG
TATAGCCTAA TTACAGTGGT AGTCAACATA GAGCCTACAC AACCTTTTCT TGGTTTCATT CAACCGTAGC AAGGACGGAG
TATATGTCTA GCTCTAGCAT AGGAGGATGA CTGAATGTAC TGCCCAAGCA GATTCC