Os03t0112700-02

Locus

Os03g0112700

Description

CCCH-type zinc finger protein, Photoperiodic control of flowering time

RAP-DB Gene Symbol Synonym(s)

EHD4, OsC3H20, C3H20, Ehd4

RAP-DB Gene Name Synonym(s)

EARLY HEADING DATE 4, Zinc finger CCCH domain-containing protein 20, Early heading date 4

CGSNL Gene Symbol

EHD4

CGSNL Gene Name

EARLY HEADING DATE 4

Oryzabase Gene Symbol Synonym(s)

OsC3H20, C3H20, Ehd4, DLN73, DLN73a, DLN73b, OsDLN73, OsDLN73a, OsDLN73b

Oryzabase Gene Name Synonym(s)

Zinc finger CCCH domain-containing protein 20, Early heading date 4, DLN repressor 73, DLN motif protein 73

Transcript Evidence

JQ828863 (Kita-ake)

Protein Evidence

J9R5R9

Literature

PMID: 23437005

PMID: 18221561

Note

Manual Curation

November 18, 2015

Gene Ontology (GO)

Molecular Function: metal ion binding (GO:0046872)

Functional domain (InterPro)

Zinc finger, CCCH-type (IPR000571)

Others

Oryzabase (8584)

Transcript

3207 bp

>Os03t0112700-02 CCCH-type zinc finger protein, Photoperiodic control of flowering time
ACGCTCTGGTGAATGGAACAATCAACACAACAGTGAACTGTGGAGTCCATCCATGCCGCA
GACAAGTTCTAGTGCACACAGTAACGTGGAATCTCATCACGATCATTATCCTTCGTGGTC
ACAGGTTCAACATGATCCTAAAAATAGTTTACAAGCAGGTTCTGGGAAGGATCTGAATTC
GAGGTATGATATTGCGCAGAAACTTCCTAGTCAACGGATCACGAGAGATGTTCCCAGCCC
TGTATTTGCCTGGAGTCCATCTGAGTCCAGGACTGCTTCCAGTCAACATGAAGGTTCTTG
CTTGAGTTCAACAACCAATCTATGCACTCATGATGAACTTCATTCTTCAATTGCTTCTGC
AAAGGCTAAAAGCTTTGCTCCAGCAACTCCTGTTGAAGACAGAGGTTCAAGCTCACCCTC
TGGTATGCTGAGTCTCTCGGAAAGAGCACCAATCTGCAGTCCACAGTCAGCTCCTTCTGC
GTCTGCTTCTGATACATGCAAGATGGAGGAGAACATGAATCAACAAAAAACACTTGAAGC
TGATATATCAAACACGTCAGTTAATCAGTCTCCACAGTCTAAGATTCTCCCTGAATCTTC
TCCTGATAACCAAGATGCTGAACATGAATATCGTAGTCCACCTCCAATATCTGAGAGTAA
AGAGTTATCCCCACAGTCAAGGACTACCCCTGGATCTTCTCCTGATAACCAAGATACTGA
ACGTGAATATCCTAGCCCGCCTCCAATATCTGGGAGTAAAGAGATATCCCCACAGTCAAG
GACTATCCTTGAATCTTCTCCTGATAACCAAGATAATGGACATGAATATCCTAGTCCACC
TCCGATACCGGAGAGTATAGAGCTATCTCCGCATTCTAAGGCTCTCCCTGAATCTTCTCC
TGATAACCAAGATATTGAACCTGAATGCCCTAGTCCACCTCAAATACCCGAGAGTAAAGA
GCTATCTCGGCAGTCTAAGATTCTCCCTGAATCATCTCCTGGTAACCAAGATATTGAACC
TGAATGCCCTAGTCCACCGCAAATACCTGAGAGTAAAGAGCTATCTCAGCAGTCTAAGAT
TCTCCCTGAATCCTCTCCTGATAACCACGATATTAAATGTGAATATTCCAGTCCAACTCC
GATACCCGAGAGTAAAGAGCTATCTCTGCAGTCTAAGATTCTCCCTGAATCTTCTTCTGA
TAACCAAGATATTAAGTGTGAAGATCCTAGCCCAACTCCGATATCTAAGAGTAAAGAGGT
GTCTCCGCAATCTAAGATTCTCTCTGAATCTTATCTTGATAACCAAGATGTTGAACGTGA
GTGTCCTAGTTCCATTCTGATAACTGAGAGTAAAGAGCTTGCTGTGGACCTCCCTGGATC
AATATCATTAGCACCTGAAAAAACAGCTTCTACTGATGTAGGTGAAAACTCTTCACTTGC
TTTTATTTTTCCAAAATCTACTCTGGCTGGGGATGATGCTTTGAAATCAGTATTTGATAT
GGCAAAGGCGCATTTAGAATGTGAAGATTCAAAGGTTAAAGAAGAACTGTATGTTGAATC
AACTGTTGTTATAAGAGATGACATGGTTGTTAATCCTGCCTCTGGAGTTGAGTCCATAGA
CATGTCTGAAAATCTCTTGGAATCTTTGATGGAGCAAAGTTGTGGAACTTTTTACATGGA
TGGTACAACAGCCTTAGAAGGTTTTCTGTCTGGTTCAACGAAGGAAGAACCGCAATGTTC
TAGCCCCATTGCTTTATCCACATGCTCTAGCCCCATTGCATTATCCCCTTGGGGTGAACA
TGGCTACTATCAAGGAGATTCTGTTGGTTCTTCTTTATGGGGTGTCCAGGACGATGATCC
AATCGGTAATATTTGGCCATTATCCTCACAAGCACCGGCTCTCCAGTATTCATCTGCAGG
TAGCACTGCTCATTTTATTGATGAAGCAACTGTCACCCATGGAAATAATGGAGTTGTTCT
AAGTAGCACGCCAGGGGAGGAGGTGGGTTTACCAAACTCAGGTGTTTGCACAGATTGGGG
ATTGGTTGAGCAGGTGAATCCAGAAACAAATGATGCATCGGTATCAATGATAGACAAGAA
CTCAGGATTAGTAGATTCTCAACCATCAGCAAATGATGGCTCAGATGTGGGTACTGCACG
GAACACTAACCATAATACTAACTTGTCCCTCAACCATGAAACAGCGGTACCCTTGAGTAG
AAGTTCTGGAGAAGCATCAAGAAAACACGGATTTATTACTGACTTGAATGTTGCTACTTC
AGAGGAGGCGTTAGGGAACACCAAGAACTGGAATCCATATGCTGGTAATGCTAATCGGGG
CAGCCAGCGGAATCATCACCGTGACAGGTACTCTCAAATAAGCGAATCTTGGCTTCTTAG
CTCAAACTACTCTAGGAGTAGGTCTGATGGATTTGGCACTGGTGGATCGTCGAGATCAAC
CCCAAGGGGACAAACTCAGAGGGGGATATGTAAATTTCATGAGAATGGCTACTGCAGGAA
GGGTGCATCTTGTAACTACCTGCACCCCTGATCTCTGCAATAGATAACGAGGGTTTGCAT
TCTTTGCCCATATCTTTTGACTTTTTTGTATAGCCTAATTACAGTGGTAGTCAACATAGA
GCCTACACAACCTTTTCTTGGTTTCATTCAACCGTAGCAAGGACGGAGTATATGTCTAGC
TCTAGCATAGGAGGATGACTGAATGTACTGCCCAAGCAGATTCCACTCTTTTGGGGACAC
GGCCTATTTTCGTTTTGCTTGGTTCAATTGAACTGCATCTGTGTATCCCTATCCCTATTG
TTCCCCGCTTTTGTTTCTTCGAGGCCTGAGGCCTGACCCGCATCCGCCAGATGTATCGGA
AAATAGCGATATGTAACCCATCGGTTTAGTTTCTGATTTGTCTTATGTTGACAGAATGTA
TTCGGTATTAGTACACTGGGTTAGGATAGTTATTTAGCATTTTGACTAGTTATAAATGAT
ACTACTACTTAACAGTATACATGATGTGATTGTGATATTAACATGCTGATACTGTGCACC
GAAATTTGGTAGAGGATGGCTTGTCGAAGGTCAGATATACAACAGTACAAGTTAGGCAGC
TGATTACTGAATTTGTATTAAGGGACTTGTGGAATAGTTTATCGGTTGTCGTCATTACTC
CTGTATCCAGTGTCCATTTCGTGGCTC

CDS

2499 bp

>Os03t0112700-02 CCCH-type zinc finger protein, Photoperiodic control of flowering time
ATGCCGCAGACAAGTTCTAGTGCACACAGTAACGTGGAATCTCATCACGATCATTATCCT
TCGTGGTCACAGGTTCAACATGATCCTAAAAATAGTTTACAAGCAGGTTCTGGGAAGGAT
CTGAATTCGAGGTATGATATTGCGCAGAAACTTCCTAGTCAACGGATCACGAGAGATGTT
CCCAGCCCTGTATTTGCCTGGAGTCCATCTGAGTCCAGGACTGCTTCCAGTCAACATGAA
GGTTCTTGCTTGAGTTCAACAACCAATCTATGCACTCATGATGAACTTCATTCTTCAATT
GCTTCTGCAAAGGCTAAAAGCTTTGCTCCAGCAACTCCTGTTGAAGACAGAGGTTCAAGC
TCACCCTCTGGTATGCTGAGTCTCTCGGAAAGAGCACCAATCTGCAGTCCACAGTCAGCT
CCTTCTGCGTCTGCTTCTGATACATGCAAGATGGAGGAGAACATGAATCAACAAAAAACA
CTTGAAGCTGATATATCAAACACGTCAGTTAATCAGTCTCCACAGTCTAAGATTCTCCCT
GAATCTTCTCCTGATAACCAAGATGCTGAACATGAATATCGTAGTCCACCTCCAATATCT
GAGAGTAAAGAGTTATCCCCACAGTCAAGGACTACCCCTGGATCTTCTCCTGATAACCAA
GATACTGAACGTGAATATCCTAGCCCGCCTCCAATATCTGGGAGTAAAGAGATATCCCCA
CAGTCAAGGACTATCCTTGAATCTTCTCCTGATAACCAAGATAATGGACATGAATATCCT
AGTCCACCTCCGATACCGGAGAGTATAGAGCTATCTCCGCATTCTAAGGCTCTCCCTGAA
TCTTCTCCTGATAACCAAGATATTGAACCTGAATGCCCTAGTCCACCTCAAATACCCGAG
AGTAAAGAGCTATCTCGGCAGTCTAAGATTCTCCCTGAATCATCTCCTGGTAACCAAGAT
ATTGAACCTGAATGCCCTAGTCCACCGCAAATACCTGAGAGTAAAGAGCTATCTCAGCAG
TCTAAGATTCTCCCTGAATCCTCTCCTGATAACCACGATATTAAATGTGAATATTCCAGT
CCAACTCCGATACCCGAGAGTAAAGAGCTATCTCTGCAGTCTAAGATTCTCCCTGAATCT
TCTTCTGATAACCAAGATATTAAGTGTGAAGATCCTAGCCCAACTCCGATATCTAAGAGT
AAAGAGGTGTCTCCGCAATCTAAGATTCTCTCTGAATCTTATCTTGATAACCAAGATGTT
GAACGTGAGTGTCCTAGTTCCATTCTGATAACTGAGAGTAAAGAGCTTGCTGTGGACCTC
CCTGGATCAATATCATTAGCACCTGAAAAAACAGCTTCTACTGATGTAGGTGAAAACTCT
TCACTTGCTTTTATTTTTCCAAAATCTACTCTGGCTGGGGATGATGCTTTGAAATCAGTA
TTTGATATGGCAAAGGCGCATTTAGAATGTGAAGATTCAAAGGTTAAAGAAGAACTGTAT
GTTGAATCAACTGTTGTTATAAGAGATGACATGGTTGTTAATCCTGCCTCTGGAGTTGAG
TCCATAGACATGTCTGAAAATCTCTTGGAATCTTTGATGGAGCAAAGTTGTGGAACTTTT
TACATGGATGGTACAACAGCCTTAGAAGGTTTTCTGTCTGGTTCAACGAAGGAAGAACCG
CAATGTTCTAGCCCCATTGCTTTATCCACATGCTCTAGCCCCATTGCATTATCCCCTTGG
GGTGAACATGGCTACTATCAAGGAGATTCTGTTGGTTCTTCTTTATGGGGTGTCCAGGAC
GATGATCCAATCGGTAATATTTGGCCATTATCCTCACAAGCACCGGCTCTCCAGTATTCA
TCTGCAGGTAGCACTGCTCATTTTATTGATGAAGCAACTGTCACCCATGGAAATAATGGA
GTTGTTCTAAGTAGCACGCCAGGGGAGGAGGTGGGTTTACCAAACTCAGGTGTTTGCACA
GATTGGGGATTGGTTGAGCAGGTGAATCCAGAAACAAATGATGCATCGGTATCAATGATA
GACAAGAACTCAGGATTAGTAGATTCTCAACCATCAGCAAATGATGGCTCAGATGTGGGT
ACTGCACGGAACACTAACCATAATACTAACTTGTCCCTCAACCATGAAACAGCGGTACCC
TTGAGTAGAAGTTCTGGAGAAGCATCAAGAAAACACGGATTTATTACTGACTTGAATGTT
GCTACTTCAGAGGAGGCGTTAGGGAACACCAAGAACTGGAATCCATATGCTGGTAATGCT
AATCGGGGCAGCCAGCGGAATCATCACCGTGACAGGTACTCTCAAATAAGCGAATCTTGG
CTTCTTAGCTCAAACTACTCTAGGAGTAGGTCTGATGGATTTGGCACTGGTGGATCGTCG
AGATCAACCCCAAGGGGACAAACTCAGAGGGGGATATGTAAATTTCATGAGAATGGCTAC
TGCAGGAAGGGTGCATCTTGTAACTACCTGCACCCCTGA

Protein

833 aa

>Os03t0112700-02 CCCH-type zinc finger protein, Photoperiodic control of flowering time
MPQTSSSAHSNVESHHDHYPSWSQVQHDPKNSLQAGSGKDLNSRYDIAQKLPSQRITRDV
PSPVFAWSPSESRTASSQHEGSCLSSTTNLCTHDELHSSIASAKAKSFAPATPVEDRGSS
SPSGMLSLSERAPICSPQSAPSASASDTCKMEENMNQQKTLEADISNTSVNQSPQSKILP
ESSPDNQDAEHEYRSPPPISESKELSPQSRTTPGSSPDNQDTEREYPSPPPISGSKEISP
QSRTILESSPDNQDNGHEYPSPPPIPESIELSPHSKALPESSPDNQDIEPECPSPPQIPE
SKELSRQSKILPESSPGNQDIEPECPSPPQIPESKELSQQSKILPESSPDNHDIKCEYSS
PTPIPESKELSLQSKILPESSSDNQDIKCEDPSPTPISKSKEVSPQSKILSESYLDNQDV
ERECPSSILITESKELAVDLPGSISLAPEKTASTDVGENSSLAFIFPKSTLAGDDALKSV
FDMAKAHLECEDSKVKEELYVESTVVIRDDMVVNPASGVESIDMSENLLESLMEQSCGTF
YMDGTTALEGFLSGSTKEEPQCSSPIALSTCSSPIALSPWGEHGYYQGDSVGSSLWGVQD
DDPIGNIWPLSSQAPALQYSSAGSTAHFIDEATVTHGNNGVVLSSTPGEEVGLPNSGVCT
DWGLVEQVNPETNDASVSMIDKNSGLVDSQPSANDGSDVGTARNTNHNTNLSLNHETAVP
LSRSSGEASRKHGFITDLNVATSEEALGNTKNWNPYAGNANRGSQRNHHRDRYSQISESW
LLSSNYSRSRSDGFGTGGSSRSTPRGQTQRGICKFHENGYCRKGASCNYLHP*

5'UTR

chr03:717447..717498 (+ strand) : 52 bp

CDS

chr03:717499..719362 (+ strand) : 1864 bp

chr03:719462..719598 (+ strand) : 137 bp

chr03:719684..720181 (+ strand) : 498 bp

3'UTR

chr03:720182..720837 (+ strand) : 656 bp

FASTA

>Os03t0112700-02 class=Sequence position=chr03:717447..720837 (+ strand)
ACGCTCTGGT GAATGGAACA ATCAACACAA CAGTGAACTG TGGAGTCCAT CCATGCCGCA GACAAGTTCT AGTGCACACA
GTAACGTGGA ATCTCATCAC GATCATTATC CTTCGTGGTC ACAGGTTCAA CATGATCCTA AAAATAGTTT ACAAGCAGGT
TCTGGGAAGG ATCTGAATTC GAGGTATGAT ATTGCGCAGA AACTTCCTAG TCAACGGATC ACGAGAGATG TTCCCAGCCC
TGTATTTGCC TGGAGTCCAT CTGAGTCCAG GACTGCTTCC AGTCAACATG AAGGTTCTTG CTTGAGTTCA ACAACCAATC
TATGCACTCA TGATGAACTT CATTCTTCAA TTGCTTCTGC AAAGGCTAAA AGCTTTGCTC CAGCAACTCC TGTTGAAGAC
AGAGGTTCAA GCTCACCCTC TGGTATGCTG AGTCTCTCGG AAAGAGCACC AATCTGCAGT CCACAGTCAG CTCCTTCTGC
GTCTGCTTCT GATACATGCA AGATGGAGGA GAACATGAAT CAACAAAAAA CACTTGAAGC TGATATATCA AACACGTCAG
TTAATCAGTC TCCACAGTCT AAGATTCTCC CTGAATCTTC TCCTGATAAC CAAGATGCTG AACATGAATA TCGTAGTCCA
CCTCCAATAT CTGAGAGTAA AGAGTTATCC CCACAGTCAA GGACTACCCC TGGATCTTCT CCTGATAACC AAGATACTGA
ACGTGAATAT CCTAGCCCGC CTCCAATATC TGGGAGTAAA GAGATATCCC CACAGTCAAG GACTATCCTT GAATCTTCTC
CTGATAACCA AGATAATGGA CATGAATATC CTAGTCCACC TCCGATACCG GAGAGTATAG AGCTATCTCC GCATTCTAAG
GCTCTCCCTG AATCTTCTCC TGATAACCAA GATATTGAAC CTGAATGCCC TAGTCCACCT CAAATACCCG AGAGTAAAGA
GCTATCTCGG CAGTCTAAGA TTCTCCCTGA ATCATCTCCT GGTAACCAAG ATATTGAACC TGAATGCCCT AGTCCACCGC
AAATACCTGA GAGTAAAGAG CTATCTCAGC AGTCTAAGAT TCTCCCTGAA TCCTCTCCTG ATAACCACGA TATTAAATGT
GAATATTCCA GTCCAACTCC GATACCCGAG AGTAAAGAGC TATCTCTGCA GTCTAAGATT CTCCCTGAAT CTTCTTCTGA
TAACCAAGAT ATTAAGTGTG AAGATCCTAG CCCAACTCCG ATATCTAAGA GTAAAGAGGT GTCTCCGCAA TCTAAGATTC
TCTCTGAATC TTATCTTGAT AACCAAGATG TTGAACGTGA GTGTCCTAGT TCCATTCTGA TAACTGAGAG TAAAGAGCTT
GCTGTGGACC TCCCTGGATC AATATCATTA GCACCTGAAA AAACAGCTTC TACTGATGTA GGTGAAAACT CTTCACTTGC
TTTTATTTTT CCAAAATCTA CTCTGGCTGG GGATGATGCT TTGAAATCAG TATTTGATAT GGCAAAGGCG CATTTAGAAT
GTGAAGATTC AAAGGTTAAA GAAGAACTGT ATGTTGAATC AACTGTTGTT ATAAGAGATG ACATGGTTGT TAATCCTGCC
TCTGGAGTTG AGTCCATAGA CATGTCTGAA AATCTCTTGG AATCTTTGAT GGAGCAAAGT TGTGGAACTT TTTACATGGA
TGGTACAACA GCCTTAGAAG GTTTTCTGTC TGGTTCAACG AAGGAAGAAC CGCAATGTTC TAGCCCCATT GCTTTATCCA
CATGCTCTAG CCCCATTGCA TTATCCCCTT GGGGTGAACA TGGCTACTAT CAAGGAGATT CTGTTGGTTC TTCTTTATGG
GGTGTCCAGG ACGATGATCC AATCGGTAAT ATTTGGCCAT TATCCTCACA AGCACCGGCT CTCCAGTATT CATCTGGTTA
GTCTGTTGAT GTTTAGCATG CATCCATTAG TCCTAAACAG TTTGTGGTGT TTAGCTTACA CCTACTAATT TTGCATTGTA
AAATTCTCTC TCCAGCAGGT AGCACTGCTC ATTTTATTGA TGAAGCAACT GTCACCCATG GAAATAATGG AGTTGTTCTA
AGTAGCACGC CAGGGGAGGA GGTGGGTTTA CCAAACTCAG GTGTTTGCAC AGATTGGGGA TTGGTTGAGC AGGTAATGAT
ATTCCAACAT CATGTCAGCC TTTGACATTT GCTTTGTGTA TGACATTCCA TTTGACATTG GGTTCTCACT ACAATAGGTG
AATCCAGAAA CAAATGATGC ATCGGTATCA ATGATAGACA AGAACTCAGG ATTAGTAGAT TCTCAACCAT CAGCAAATGA
TGGCTCAGAT GTGGGTACTG CACGGAACAC TAACCATAAT ACTAACTTGT CCCTCAACCA TGAAACAGCG GTACCCTTGA
GTAGAAGTTC TGGAGAAGCA TCAAGAAAAC ACGGATTTAT TACTGACTTG AATGTTGCTA CTTCAGAGGA GGCGTTAGGG
AACACCAAGA ACTGGAATCC ATATGCTGGT AATGCTAATC GGGGCAGCCA GCGGAATCAT CACCGTGACA GGTACTCTCA
AATAAGCGAA TCTTGGCTTC TTAGCTCAAA CTACTCTAGG AGTAGGTCTG ATGGATTTGG CACTGGTGGA TCGTCGAGAT
CAACCCCAAG GGGACAAACT CAGAGGGGGA TATGTAAATT TCATGAGAAT GGCTACTGCA GGAAGGGTGC ATCTTGTAAC
TACCTGCACC CCTGATCTCT GCAATAGATA ACGAGGGTTT GCATTCTTTG CCCATATCTT TTGACTTTTT TGTATAGCCT
AATTACAGTG GTAGTCAACA TAGAGCCTAC ACAACCTTTT CTTGGTTTCA TTCAACCGTA GCAAGGACGG AGTATATGTC
TAGCTCTAGC ATAGGAGGAT GACTGAATGT ACTGCCCAAG CAGATTCCAC TCTTTTGGGG ACACGGCCTA TTTTCGTTTT
GCTTGGTTCA ATTGAACTGC ATCTGTGTAT CCCTATCCCT ATTGTTCCCC GCTTTTGTTT CTTCGAGGCC TGAGGCCTGA
CCCGCATCCG CCAGATGTAT CGGAAAATAG CGATATGTAA CCCATCGGTT TAGTTTCTGA TTTGTCTTAT GTTGACAGAA
TGTATTCGGT ATTAGTACAC TGGGTTAGGA TAGTTATTTA GCATTTTGAC TAGTTATAAA TGATACTACT ACTTAACAGT
ATACATGATG TGATTGTGAT ATTAACATGC TGATACTGTG CACCGAAATT TGGTAGAGGA TGGCTTGTCG AAGGTCAGAT
ATACAACAGT ACAAGTTAGG CAGCTGATTA CTGAATTTGT ATTAAGGGAC TTGTGGAATA GTTTATCGGT TGTCGTCATT
ACTCCTGTAT CCAGTGTCCA TTTCGTGGCT C