Os03t0123100-01

Locus

Os03g0123100

Description

SUMO conjugating enzyme

RAP-DB Gene Symbol Synonym(s)

OsSCE2

RAP-DB Gene Name Synonym(s)

SUMO-conjugating enzyme 2

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSce2, Sce2, OsUBC2, UBC2, OsSCE1a, SCE1a, OsSCE1a.1, OsSCE1a.2

Oryzabase Gene Name Synonym(s)

SUMO-conjugating enzyme 2, Ubiquitin-conjugating enzyme 2, E2 SUMO conjugation enzyme 1a, SUMO conjugation enzyme 1a, E2 protein SCE1a

Transcript Evidence

AK062161

AK102397

Protein Evidence

Q8H8G9

Literature

PMID: 31212102

Note

Manual Curation

June 20, 2019

Functional domain (InterPro)

Ubiquitin-conjugating enzyme/RWD-like (IPR016135)

Ubiquitin-conjugating enzyme E2 (IPR000608)

Ubiquitin-conjugating enzyme, active site (IPR023313)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

001-046-B02 (Online Clone Ordering)

J033092H08 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0123100-01)

Others

Oryzabase (13203)

Transcript

980 bp

>Os03t0123100-01 SUMO conjugating enzyme
AAACCCCCACCGCCGGAGGAAGGAGGAGACGCCGCCGCCGCCGCCGCAGCCATGTCGGGG
GGAATCGCGCGCGGCCGCCTCGCGGAGGAGCGGAAGGCGTGGCGGAAGAACCACCCACAC
GGTTTCGTCGCCAAGCCGGAGACGTTGGCCGACGGGACGGTCAACCTCATGATCTGGCAC
TGCACAATCCCCGGCAAGCAAGGGACTGATTGGGAAGGTGGATACTTTCCTCTCACTCTT
CATTTCAGTGAGGATTACCCTAGCAAACCTCCCAAGTGCAAGTTCCCACAGGGTTTCTTC
CACCCAAATGTCTATCCTTCAGGGACAGTCTGCCTTTCAATTCTTAATGAAGACAGCGGT
TGGAGACCTGCTATTACCGTCAAGCAAATTCTTGTTGGAATCCAGGACTTGCTTGATCAG
CCTAATCCTGCTGATCCTGCTCAGACCGATGGTTACCATCTTTTTATCCAGGATCCTACG
GAATACAAGAGGCGTGTTCGGCTGCAGGCCAAGCAGTATCCTCCGATTGTCTGAGAATAT
TGGCATAGGGACCCATGCTGCACATTCGCTTAGTTCTTGCTAGATCTAAAATGAGTGCCT
CTGCAAATATGGATTAGACCAAAATATGACCTGGAAAAAGGGTGCTTTCGGAGTTTGAGA
AGTATTATCATCGTTGTGGACTAATGTCTTGTGAGATCCGTCTTGGATGTAAACGGTTTT
CTTAACTGTGATTTTTCAACCGTTTGAGTGCTTGCTTTATGGGATAATGTCAAACATTGG
TTTGGCAGGCAATCTCAAGAGTATTGCTATTTCTGTGCTAGTCTATATGAAAACCCAGAT
TAAATTCGACGAAACATATTAGTTTGCAAAAAGATGTGGCAACTTCCATATTTTCTGCAT
TTTTTTCTGTTTTGATCCGGATCTGTCGGCTATACAGAGGTGAAAATAATGTAAACGTCG
GAGGCGTAAGTACACAGTGC

CDS

483 bp

>Os03t0123100-01 SUMO conjugating enzyme
ATGTCGGGGGGAATCGCGCGCGGCCGCCTCGCGGAGGAGCGGAAGGCGTGGCGGAAGAAC
CACCCACACGGTTTCGTCGCCAAGCCGGAGACGTTGGCCGACGGGACGGTCAACCTCATG
ATCTGGCACTGCACAATCCCCGGCAAGCAAGGGACTGATTGGGAAGGTGGATACTTTCCT
CTCACTCTTCATTTCAGTGAGGATTACCCTAGCAAACCTCCCAAGTGCAAGTTCCCACAG
GGTTTCTTCCACCCAAATGTCTATCCTTCAGGGACAGTCTGCCTTTCAATTCTTAATGAA
GACAGCGGTTGGAGACCTGCTATTACCGTCAAGCAAATTCTTGTTGGAATCCAGGACTTG
CTTGATCAGCCTAATCCTGCTGATCCTGCTCAGACCGATGGTTACCATCTTTTTATCCAG
GATCCTACGGAATACAAGAGGCGTGTTCGGCTGCAGGCCAAGCAGTATCCTCCGATTGTC
TGA

Protein

161 aa

>Os03t0123100-01 SUMO conjugating enzyme
MSGGIARGRLAEERKAWRKNHPHGFVAKPETLADGTVNLMIWHCTIPGKQGTDWEGGYFP
LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
LDQPNPADPAQTDGYHLFIQDPTEYKRRVRLQAKQYPPIV*

5'UTR

chr03:1318268..1318318 (+ strand) : 51 bp

CDS

chr03:1318319..1318387 (+ strand) : 69 bp

chr03:1318498..1318581 (+ strand) : 84 bp

chr03:1320671..1320823 (+ strand) : 153 bp

chr03:1320906..1321019 (+ strand) : 114 bp

chr03:1321131..1321193 (+ strand) : 63 bp

3'UTR

chr03:1321194..1321639 (+ strand) : 446 bp

FASTA

>Os03t0123100-01 class=Sequence position=chr03:1318268..1321639 (+ strand)
AAACCCCCAC CGCCGGAGGA AGGAGGAGAC GCCGCCGCCG CCGCCGCAGC CATGTCGGGG GGAATCGCGC GCGGCCGCCT
CGCGGAGGAG CGGAAGGCGT GGCGGAAGAA CCACCCACAC GTCGGTGCCT CTCGATCTCA ACGCCTCCCC TCTTTTTTTT
TTTAATCCCT TTTACATGTC GCGCCGCGGG GCTTGATCCC CCTGATCTGT GTTCTGATTT GGTTCCGTAG GGTTTCGTCG
CCAAGCCGGA GACGTTGGCC GACGGGACGG TCAACCTCAT GATCTGGCAC TGCACAATCC CCGGCAAGCA AGGGGTAAGC
ATCGCCCTGA ATGCTACACT GAATTTAATA GTAAGAGTAC AACTTGAAAT TCGAGAGGCC TCTCTGGTTC TCGTCCGATT
CTGAACCAGG ATGGTTTCGA TGGTTATCCC GTTAGCTATC CACTGTGTTA TCAGATGGAT CTCTTCAGGC GGAGATTATT
TCAGTGCCAT CTCCCTCTTG TTTTGGGAGA TCGGAATTAG GGATTGTGCT GTAGTACATT TGTTGCCATG GCCTGGGTTT
GAGGTGTGGT GCTTTTGTGC CGCGAAAAGA CTGTCTTTTT TTTGGGCTAG CCAAACTGTT TTCACCATAG ATCGAAGTTG
AGTTCTGGTT CACTGTCAGT CACCAAGCTT TTGCATGATG TGCTTACATG CTTTAAAACC AGTCTTCATT TCAGCAACTA
CTGCAAACCG TAGGTAGAAG GGAGTATTGC CTCAAATGAT ATATCAAAGG GTGAAACCAG TCTTCATTTC AGCAAGACAG
CAACTACCAT AGGATGAAGG GAGTATTGCC CCGAATGATA TATAAAAAGA TGGACTGGGC ATTAAAATCA AGTGCACACA
TAAATTCGGT TGAATTATAC ACGTGGGCTT CTGCAAGTTC TTATCATTTA CTAGGCCAAA TAAGCGAGTA GAATGTCATG
AAAAAGATAA TACTACTCAG TAGGTCTGGA TTAACACTAT TTCATATTTG TTGCGGGTTC TCTTTTATGG TCAGATTCAG
CTTTGACAAA AGACAACAAA GAGGAATAGT GATTGCGTGT GTCATGTGCG TGCATGAGGG ACCATGTGCA GTCTCTCCTT
CAGGAGTTTG ACCAAGTTAG GAGTCCTTGA GATAGAATAG CTCGATTTCT TGTTGGCTCA GTTTGGTCTA GAAGAAGTTT
GAACAAACTA GAGAGCATTT GAGCAGGAAT TGCTGACATT TATCTAGCCT TTTAAAAGTG GCATGCGTAG TACTACCTCC
GTACACTAAA GGATGACGCT TTAATGTTGG GCACAGAGAA CAGCACAGTT TAACTGCTGA GGAAAATAGA AAAAAATTGC
CCCTTCATTA GTATTACTAA TAGCTCATGC TCCATAAATA ATGATAATAA TAAATGTTCA TGCATTCTAA TCCAATGACC
CACAAGAGTG CATTGGCATT GATTAGTGCA AGCACCAGTT TGCCACGAGT GGATGTGAGC GAACGCTAGG CCATGCGAAT
CTCCGATCAA AATATTATGG CTTCCTTAGA TTTCAATTAG ATACACCAAA CGCTCTCTTG AATTAATCCA AAGTTTGGCC
TTATAGCTCC CCTTTTTAGG GTAGCGGTGA CCGGTGATAT TGGAAAAATG TTGCCTAAAA AATCTAAAAC ATCATCTACT
GAAGAACAAA ATCAAAATCC TAAAACATCA CATAAAAGGG CAGGGGTAAT AACATTTTGA ACTTGTTAGC ACACCCTCAG
GCCTTGCTCT GCACATTAGT TGTGATGTGA GCCAAGTTTC ACATTATTCA AGCTAACACG ATCTCTTACA AAACATCACC
ATCCAGAGAT TTTCATATCT TTACATGTAT TACCACTGTC TGGTAACATT ATCTTAGTGT TTTAGAAAAT ATATGAAACC
CAGTAAGTTC CTGGCAACCT AGGCTGTCCT GCCATTTGTA GGTGCTTTGG TGTGATTTAG GATATATTAA TGTTCCTTCT
ATCTGAAGCA AATATAAATT AAGACTTTGA AACATGTCCA TATTTACGTG TTACAGCTTT TTTTAATACT CAGAATCCTT
TGAAACATGT CCTTGGTGGT GTAACACAGT AATATATATT TTTTTCCTGA AAAGACTTAT TTTTTCTGTT AACAAACAAA
ATTGTTTGCT TTTACTTCAT CAGTCTTCTA TATTTCTAAC GTGTTGATTG ATGTTATGCT TTGAATTCTT GCACATGGTC
AGCTTATATG TTACTTTCTC AAGCTTGTCA TACTTTACAA AACTACATTC TTATATTGCT TCTCTGTTCA TGTAGAGAAG
TGTTTGTAAA AAGGCATTGC AGCTAGAAGC CTATAACTAA TGCACATCTC TCTCTCTCTC TCTCTCTCTC TCTCTTTTGG
CAGACTGATT GGGAAGGTGG ATACTTTCCT CTCACTCTTC ATTTCAGTGA GGATTACCCT AGCAAACCTC CCAAGTGCAA
GTTCCCACAG GGTTTCTTCC ACCCAAATGT CTATCCTTCA GGGACAGTCT GCCTTTCAAT TCTTAATGAA GACAGCGTAA
GCTTTACAAG CATTTATTAG GTTTTTAGCA ATCCCAATTT AGATATCATT TATAACTGTT CTGATTTTCT GCTTTCAGGG
TTGGAGACCT GCTATTACCG TCAAGCAAAT TCTTGTTGGA ATCCAGGACT TGCTTGATCA GCCTAATCCT GCTGATCCTG
CTCAGACCGA TGGTTACCAT CTTTTTATCC AGGTTAGCCA TCAGTAAAAA GTGACCAATC AGGGTTCTGC TAATTTTTAC
TATAAATCAA TAATGCTAAG ATATTCAAGC TTTGTAGTTT TAATGTGCTC TTTGGGTTTG CAGGATCCTA CGGAATACAA
GAGGCGTGTT CGGCTGCAGG CCAAGCAGTA TCCTCCGATT GTCTGAGAAT ATTGGCATAG GGACCCATGC TGCACATTCG
CTTAGTTCTT GCTAGATCTA AAATGAGTGC CTCTGCAAAT ATGGATTAGA CCAAAATATG ACCTGGAAAA AGGGTGCTTT
CGGAGTTTGA GAAGTATTAT CATCGTTGTG GACTAATGTC TTGTGAGATC CGTCTTGGAT GTAAACGGTT TTCTTAACTG
TGATTTTTCA ACCGTTTGAG TGCTTGCTTT ATGGGATAAT GTCAAACATT GGTTTGGCAG GCAATCTCAA GAGTATTGCT
ATTTCTGTGC TAGTCTATAT GAAAACCCAG ATTAAATTCG ACGAAACATA TTAGTTTGCA AAAAGATGTG GCAACTTCCA
TATTTTCTGC ATTTTTTTCT GTTTTGATCC GGATCTGTCG GCTATACAGA GGTGAAAATA ATGTAAACGT CGGAGGCGTA
AGTACACAGT GC

Locus: Os03g0123100

Loading...

Locus: Os03g0123100

Loading...