Os03t0125100-01

Locus

Os03g0125100

Description

Beta-carotene hydroxylase, Drought and oxidative stress resistance

RAP-DB Gene Symbol Synonym(s)

DSM2, OsBCH1, OsHYD3

RAP-DB Gene Name Synonym(s)

beta-Carotene Hydroxylase 1, carotene beta-ring hydroxylase 3

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

DSM2, OsDSM2, OsBCH1, BCH1, OsHYD3

Oryzabase Gene Name Synonym(s)

beta-Carotene Hydroxylase 1, carotene beta-ring hydroxylase 3

Transcript Evidence

AK287823 (Genbank)

Protein Evidence

Q10SE7 (UniProt)

Literature

PMID: 20852032

PMID: 19767386

Note

Manual Curation

November 24, 2010

Gene Ontology (GO)

Biological Process: fatty acid biosynthetic process (GO:0006633)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Fatty acid hydroxylase (IPR006694)

Full-length cDNA

J065184D15 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0125100-01)

Others

Oryzabase (18457)

KEGG (Os03t0125100-01)

Transcript

1159 bp

>Os03t0125100-01 Beta-carotene hydroxylase, Drought and oxidative stress resistance
GCGTAGGCTGCGGCTGCGGCATCCATGGCCGTCGCGAGGCTGGTGGCCGCGCGGGCCCCT
CTCCTCTCCCCCGCCGCGGTGGCGGCGGCACACCGATCGCCCCCGGCGCTGCTGCGGCTG
GCGTTCGCGCCGCTCCCGGCGCGGCGGCTGGCcgtccccttgcgcgtggcggtgggtgag
ccggagccggaggaggatgcgcggagggcggtggcggagcgcgcggcgcggaagcagtcg
gagcggcggacgtacctggtggcagcggtgatgtccagcctcgggatcacgtccatggcc
gcCGCCGCCGTCTACTACCGCTTCGCCTGGCAAATGGAGGGCAGCGGCGAGATCCCGGTC
ACGGAAATGTTCGGCACCTTCGCGCTATCGGTGGGCGCCGCGGTGGGGATGGAGTTCTGG
GCGCGGTGGGCGCACCGGGCGCTGTGGCACGCGTCGCTGTGGCACATGCACGAGTCGCAC
CACCGCCCGCGAGACGGGCCGTTCGAGCTCAACGACGTCTTCGCCATCACCAACGCCGTC
CCGGCCATGTCCCTCCTCGCCTACGGCTTCTTCACCCGCGGCCTCGTCCCCGGCCTCTGC
TTCGGCGCGGGACTCGGGATCACGCTGTTCGGGATGGCGTACATGTTCGTCCACGACGGC
CTGGTCCACCGCCGCTTCCCGGTGGGGCCCATCGCCAACGTGCCCTACTTCCGGCGGGTC
GCCGCCGCCCACCAGATACATCACATGGACAAGTTCGAAGGTGTGCCATATGGGCTGTTC
CTTGGTCCCAAGGAGCTGGAGGAGGTGGGTGGGATTGAGGAGCTGGAGAAGGAGATCAAG
AGGAGGATTAAGAGGAAAGAGACCTTAGATGCGATCCAATGAGAGCTACTTATCACACAT
TTTTTTCTTTTTATTTGCTGTCATCTCTTATTAGTTTTTGCTTCAGTGGCAATTGTAGCC
TTGTAATATGCTTTTCTGTCCTGTTAATAGAAGAATAATTTAGATAGATATTTGGAAGCT
CATTTGGACGGTGGAGCACACAGGTATTAGAAATGATGTGCTGGGGCTGAATGGCTGATG
CTTTTGCTAGTACTGCTGGTAATGATATATATTAATCAGTACCATTCTGAATTTATTAGT
CTGGTTGAGTCGTGCTGCT

CDS

858 bp

>Os03t0125100-01 Beta-carotene hydroxylase, Drought and oxidative stress resistance
ATGGCCGTCGCGAGGCTGGTGGCCGCGCGGGCCCCTCTCCTCTCCCCCGCCGCGGTGGCG
GCGGCACACCGATCGCCCCCGGCGCTGCTGCGGCTGGCGTTCGCGCCGCTCCCGGCGCGG
CGGCTGGCcgtccccttgcgcgtggcggtgggtgagccggagccggaggaggatgcgcgg
agggcggtggcggagcgcgcggcgcggaagcagtcggagcggcggacgtacctggtggca
gcggtgatgtccagcctcgggatcacgtccatggccgcCGCCGCCGTCTACTACCGCTTC
GCCTGGCAAATGGAGGGCAGCGGCGAGATCCCGGTCACGGAAATGTTCGGCACCTTCGCG
CTATCGGTGGGCGCCGCGGTGGGGATGGAGTTCTGGGCGCGGTGGGCGCACCGGGCGCTG
TGGCACGCGTCGCTGTGGCACATGCACGAGTCGCACCACCGCCCGCGAGACGGGCCGTTC
GAGCTCAACGACGTCTTCGCCATCACCAACGCCGTCCCGGCCATGTCCCTCCTCGCCTAC
GGCTTCTTCACCCGCGGCCTCGTCCCCGGCCTCTGCTTCGGCGCGGGACTCGGGATCACG
CTGTTCGGGATGGCGTACATGTTCGTCCACGACGGCCTGGTCCACCGCCGCTTCCCGGTG
GGGCCCATCGCCAACGTGCCCTACTTCCGGCGGGTCGCCGCCGCCCACCAGATACATCAC
ATGGACAAGTTCGAAGGTGTGCCATATGGGCTGTTCCTTGGTCCCAAGGAGCTGGAGGAG
GTGGGTGGGATTGAGGAGCTGGAGAAGGAGATCAAGAGGAGGATTAAGAGGAAAGAGACC
TTAGATGCGATCCAATGA

Protein

286 aa

>Os03t0125100-01 Beta-carotene hydroxylase, Drought and oxidative stress resistance
MAVARLVAARAPLLSPAAVAAAHRSPPALLRLAFAPLPARRLAVPLRVAVGEPEPEEDAR
RAVAERAARKQSERRTYLVAAVMSSLGITSMAAAAVYYRFAWQMEGSGEIPVTEMFGTFA
LSVGAAVGMEFWARWAHRALWHASLWHMHESHHRPRDGPFELNDVFAITNAVPAMSLLAY
GFFTRGLVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHQIHH
MDKFEGVPYGLFLGPKELEEVGGIEELEKEIKRRIKRKETLDAIQ*

5'UTR

chr03:1439032..1439055 (- strand) : 24 bp

CDS

chr03:1438717..1439031 (- strand) : 315 bp

chr03:1438552..1438614 (- strand) : 63 bp

chr03:1438261..1438467 (- strand) : 207 bp

chr03:1437202..1437327 (- strand) : 126 bp

chr03:1437022..1437078 (- strand) : 57 bp

chr03:1436633..1436722 (- strand) : 90 bp

3'UTR

chr03:1436356..1436632 (- strand) : 277 bp

FASTA

>Os03t0125100-01 class=Sequence position=chr03:1436356..1439055 (- strand)
GCGTAGGCTG CGGCTGCGGC ATCCATGGCC GTCGCGAGGC TGGTGGCCGC GCGGGCCCCT CTCCTCTCCC CCGCCGCGGT
GGCGGCGGCA CACCGATCGC CCCCGGCGCT GCTGCGGCTG GCGTTCGCGC CGCTCCCGGC GCGGCGGCTG GCcgtcccct
tgcgcgtggc ggtgggtgag ccggagccgg aggaggatgc gcggagggcg gtggcggagc gcgcggcgcg gaagcagtcg
gagcggcgga cgtacctggt ggcagcggtg atgtccagcc tcgggatcac gtccatggcc gcCGCCGCCG TCTACTACCG
CTTCGCCTGG CAAATGGAGG TAGGTAACAC GCCATCGCCA AACTCCCGCT CGCATCTTAC CATTACCCAA TTCGGCAATT
CCTTCGCCGC AGCACTAAAA TTTCTCCGCG TGCTCGACCA GGGCAGCGGC GAGATCCCGG TCACGGAAAT GTTCGGCACC
TTCGCGCTAT CGGTGGGCGC CGCGGTAAGC GCACACACAC GCACCGTCCG CACGACGCCG CGCGTCGCTC GTGTAACCGT
GTTGGTTTTG CCTTGCCATT TTGCGCAGGT GGGGATGGAG TTCTGGGCGC GGTGGGCGCA CCGGGCGCTG TGGCACGCGT
CGCTGTGGCA CATGCACGAG TCGCACCACC GCCCGCGAGA CGGGCCGTTC GAGCTCAACG ACGTCTTCGC CATCACCAAC
GCCGTCCCGG CCATGTCCCT CCTCGCCTAC GGCTTCTTCA CCCGCGGCCT CGTCCCCGGC CTCTGCTTCG GCGCGGTGAG
TGGTCGATCC TCCTCCATTT CAACCAAATC CCCATCACTT CTCTCAAACA CACTGTACCA GGATTTGACC AAGCGTGCTT
AACGTGGCCG TATTAAAATG ACAAAAGTGC ATGATGTAGT ACTATGTTCA GTTGATTACA TTCACATTCC ATGGCCGCCT
GCCAAAAAAA AATGAATTTA TCTGTCAAGA GAAGCCAAAG CGTAGAGCGA ACTCCAAAAG ATCTTGATGT CCTTGCTGCA
TCGGATAAAC AATAAAAAAT TGAACATTCG AGATCGAGAA AATTTAGAAA AACGGAGTGG CCTGGCCTCC ATGAGTTCCC
AGAGAAACCT ATAAtggatt ctaatatctt tgagggatgt tatctcgtat atttttctct ttcaaattcg atacaaatag
ttatgaattt ttttttttaa aaagtaataa tgtagagtat agtgagatct atcagtccac caaaaattat gttcaacttc
catatacaca acacgaataa aagaaaagat aattcagatg tgaacattac gctactaatc atacattgaa tttaattttt
tatatctcaa cgtgtgagtt gagtttgaat ataagatttt atgtagttgc acagatatgt tatctgagtg ttgtcaaaaa
atttcataac ctttggatat tctgtaagca aatgagagaa catccctcga atgattaaat agttccccCT ATAACGTAGA
TTGTACTAAA GCAATAGGTA TTGTTGTCGC ATTGCGACGG CGCCATGGTC ACCCATGCGA GGTACCCATC AACGGTCTCA
CCGGAACAAG TAAAATACAA GCGCTAGCAG CGTTTCTTTT TGTTCAATTT GATTGCCAAG GTTGAATTTT TGTGATCTGG
GGCTCTGGGC AGAGATGATC CAAGTGCTGA CGTGTCCGTT CGCCGCAGGG ACTCGGGATC ACGCTGTTCG GGATGGCGTA
CATGTTCGTC CACGACGGCC TGGTCCACCG CCGCTTCCCG GTGGGGCCCA TCGCCAACGT GCCCTACTTC CGGCGGGTCG
CCGCCGCCCA CCAGGTCCGG CCCGGTCGCT CTCCACCTAA CTGCAGCCGA CCACGCATCC CTGTCTCTGA GCTTCTCTTG
CCGTGGTTCT GAATTTATGT GAGCTGATCC ATCCTTGCCT GCCATTCATT CTTGCAGATA CATCACATGG ACAAGTTCGA
AGGTGTGCCA TATGGGCTGT TCCTTGGTCC CAAGGTGAGG AGATGTGTCT CATGCTATTC ATGCTTTGCT TCCTCGTGCC
CCATGCTACC ATGGATGCTT GTTGGCTTAC TCCTGCTCCA ACGGTGTCCA TTTGTCGAGT AGTTTGCATA CTTGCAGTAC
TCCTTTATTG CAAGCATGAA TTTGTGATTG GGAAGCTAAT GTAGAATTTG AACTGTGTTG ATATAAAAGG ACTGGAAATT
TTGAAATGTT CTAAGATGTA TTACAAATAT TTGTGATCGT CGGAAAAATT GTCTGAAATG TTCTAAAATG TCTCTGTTTT
ATGTGGTTGA CAGGAGCTGG AGGAGGTGGG TGGGATTGAG GAGCTGGAGA AGGAGATCAA GAGGAGGATT AAGAGGAAAG
AGACCTTAGA TGCGATCCAA TGAGAGCTAC TTATCACACA TTTTTTTCTT TTTATTTGCT GTCATCTCTT ATTAGTTTTT
GCTTCAGTGG CAATTGTAGC CTTGTAATAT GCTTTTCTGT CCTGTTAATA GAAGAATAAT TTAGATAGAT ATTTGGAAGC
TCATTTGGAC GGTGGAGCAC ACAGGTATTA GAAATGATGT GCTGGGGCTG AATGGCTGAT GCTTTTGCTA GTACTGCTGG
TAATGATATA TATTAATCAG TACCATTCTG AATTTATTAG TCTGGTTGAG TCGTGCTGCT 

Locus: Os03g0125100

Loading...

Locus: Os03g0125100

Loading...