Os03t0131900-01

Locus

Os03g0131900

Description

Chloroplast signal recognition particle 43 KD protein, Chloroplast development and photosynthesis

RAP-DB Gene Symbol Synonym(s)

OscpSRP43, cpSRP43

RAP-DB Gene Name Synonym(s)

Chloroplast Signal Recognition Particle 43, chloroplast signal recognition particle 43 KD protein

CGSNL Gene Symbol

YGL9

CGSNL Gene Name

YELLOW-GREEN LEAF 9

Oryzabase Gene Symbol Synonym(s)

OscpSRP43, cpSRP43, PGL3

Oryzabase Gene Name Synonym(s)

Chloroplast Signal Recognition Particle 43, chloroplast signal recognition particle 43 KD protein, chloroplast signal recognition particle 43 kDa protein, yellow green leaf 9, pale- green leaf 3

Transcript Evidence

Inferred from literature

Protein Evidence

Q8LSQ2

Literature

PMID: 26600124

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

November 26, 2015

Gene Ontology (GO)

Biological Process: response to light stimulus (GO:0009416)

Biological Process: protein import into chloroplast thylakoid membrane (GO:0045038)

Molecular Function: protein binding (GO:0005515)

Cellular Component: chloroplast (GO:0009507)

Cellular Component: signal recognition particle, chloroplast targeting (GO:0080085)

Functional domain (InterPro)

Signal recognition particle 43 kDa protein (IPR030300)

Chromo domain-like (IPR016197)

Chromo/chromo shadow domain (IPR000953)

Ankyrin repeat-containing domain (IPR020683)

Chromo domain (IPR023780)

Ankyrin repeat (IPR002110)

Full-length cDNA

J013114D14 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0131900-01)

RiceXPro (AK099900)

Others

Oryzabase (20299)

KEGG (Os03t0131900-01)

Transcript

1323 bp

>Os03t0131900-01 Chloroplast signal recognition particle 43 KD protein, Chloroplast development and photosynthesis
AAGCTCCTCCCACTCCAATGGAGGCTGTCCTACGACACCCATCCCTTTCCCGCCTCAAAC
CCCCCAACCCCAATGCTCAGAGAACTCCAGCCCTCTCCATCACCGTCCCTTTCCGGCTTC
GTCTCCCCAACCGGCGGCTCACCGCCGCGGCGGTGTTCCAGGACCAGACCAACCCAAGAA
ACCCAGCGAGCAAGGGAGGCGACGACGATGAGGCGTACGGCGAGGTGGACCGTATTGTGT
CCAGCCGCACCATCAAGAATCCGGTGTTCGCGGAGGACGGCTCGGCCACCACGGTCACCG
CCACGGAGTACCTCGTCGAGTGGAAGGACGGGCACGAGCCTTCGTGGATCCCGGCGGAGG
CCATAGCGGCGGACGTGGTGGCGGAGTACGAGACGCCGTGGTGGACGGCCGCCAAGAAGG
CGGACGCGGCGGAGATCACTGCGCTACTCGCGGACGAGACGCTGCGGCGTGACCCCGACG
CGGAGGATGCGCAGGGGCGCACGGCGATGCACTTCGCCGCGGGGCTTGGATCCGAGGAGT
GCGTGCGCGCGCTCGCCGAGGCCGGGGCCGACGTGGGGCGACCCGAGCGCGCCGGCGGCG
GGCTCACGCCGCTGCACATCGCGGTCGGGTACGGGCGCCCGGCGGCCGTGCGCGCGCTGC
TGGAGCTGGGCGCCGAGCCGGAGGCCCCCGACGGGCAGGGCCGGACGCCGCTGGAGCTGG
TCCAGGACGTGCTCGCGAAGACGCCCAAGGGCAACCCGGCGACGTTCGAGCGGCGGCTGG
CGCTGGAGGCGGCGGCGAAGGAGCTGGAGAAGGCCGTGTACGAGTGGGGCGAAGTGGAGA
AGGTGGTGGACGGCCGCGGCGAGGGCAAGTGGCGGGAGTACTTGGTGGAGTGGCGCGACG
GCGGCGACAGGGAGTGGGTGAGGGCGGCGTGGGTGGCGGAGGACCTGGTGAAGGACTTCG
ACGCCGGGCTGGAGTACGCCGTCGCGGAGGCCGTCGTCAACAAGAGGGAGGCGGCGGAAG
GGGAGGGGAAATGGGAGTACCTTGTCAAGTGGGTGGACATCGAGGAGGCGACGTGGGAGC
CCGCGGAGAACGTCGACGCCGAACTCCTCCAGGAGTTCGAGCAGCGGCAATCTGGGGTGG
CTGCTGGCGGTGATGCTCCGCCGCCGCCGCCGGTCGCCGGGTGACAGCGTGTCGCCGTCG
ACGGAGGGTGTTCGATTCTTCCTGGTTTTGCTGTGTTTAACAGAACGGGATAAAATGTTT
GTGCTGCTGCAAAATGTATCATTAGCGCTTTGATAATTTTTGAGTTGAGCAGAACTTTAA
CCT

CDS

1167 bp

>Os03t0131900-01 Chloroplast signal recognition particle 43 KD protein, Chloroplast development and photosynthesis
ATGGAGGCTGTCCTACGACACCCATCCCTTTCCCGCCTCAAACCCCCCAACCCCAATGCT
CAGAGAACTCCAGCCCTCTCCATCACCGTCCCTTTCCGGCTTCGTCTCCCCAACCGGCGG
CTCACCGCCGCGGCGGTGTTCCAGGACCAGACCAACCCAAGAAACCCAGCGAGCAAGGGA
GGCGACGACGATGAGGCGTACGGCGAGGTGGACCGTATTGTGTCCAGCCGCACCATCAAG
AATCCGGTGTTCGCGGAGGACGGCTCGGCCACCACGGTCACCGCCACGGAGTACCTCGTC
GAGTGGAAGGACGGGCACGAGCCTTCGTGGATCCCGGCGGAGGCCATAGCGGCGGACGTG
GTGGCGGAGTACGAGACGCCGTGGTGGACGGCCGCCAAGAAGGCGGACGCGGCGGAGATC
ACTGCGCTACTCGCGGACGAGACGCTGCGGCGTGACCCCGACGCGGAGGATGCGCAGGGG
CGCACGGCGATGCACTTCGCCGCGGGGCTTGGATCCGAGGAGTGCGTGCGCGCGCTCGCC
GAGGCCGGGGCCGACGTGGGGCGACCCGAGCGCGCCGGCGGCGGGCTCACGCCGCTGCAC
ATCGCGGTCGGGTACGGGCGCCCGGCGGCCGTGCGCGCGCTGCTGGAGCTGGGCGCCGAG
CCGGAGGCCCCCGACGGGCAGGGCCGGACGCCGCTGGAGCTGGTCCAGGACGTGCTCGCG
AAGACGCCCAAGGGCAACCCGGCGACGTTCGAGCGGCGGCTGGCGCTGGAGGCGGCGGCG
AAGGAGCTGGAGAAGGCCGTGTACGAGTGGGGCGAAGTGGAGAAGGTGGTGGACGGCCGC
GGCGAGGGCAAGTGGCGGGAGTACTTGGTGGAGTGGCGCGACGGCGGCGACAGGGAGTGG
GTGAGGGCGGCGTGGGTGGCGGAGGACCTGGTGAAGGACTTCGACGCCGGGCTGGAGTAC
GCCGTCGCGGAGGCCGTCGTCAACAAGAGGGAGGCGGCGGAAGGGGAGGGGAAATGGGAG
TACCTTGTCAAGTGGGTGGACATCGAGGAGGCGACGTGGGAGCCCGCGGAGAACGTCGAC
GCCGAACTCCTCCAGGAGTTCGAGCAGCGGCAATCTGGGGTGGCTGCTGGCGGTGATGCT
CCGCCGCCGCCGCCGGTCGCCGGGTGA

Protein

389 aa

>Os03t0131900-01 Chloroplast signal recognition particle 43 KD protein, Chloroplast development and photosynthesis
MEAVLRHPSLSRLKPPNPNAQRTPALSITVPFRLRLPNRRLTAAAVFQDQTNPRNPASKG
GDDDEAYGEVDRIVSSRTIKNPVFAEDGSATTVTATEYLVEWKDGHEPSWIPAEAIAADV
VAEYETPWWTAAKKADAAEITALLADETLRRDPDAEDAQGRTAMHFAAGLGSEECVRALA
EAGADVGRPERAGGGLTPLHIAVGYGRPAAVRALLELGAEPEAPDGQGRTPLELVQDVLA
KTPKGNPATFERRLALEAAAKELEKAVYEWGEVEKVVDGRGEGKWREYLVEWRDGGDREW
VRAAWVAEDLVKDFDAGLEYAVAEAVVNKREAAEGEGKWEYLVKWVDIEEATWEPAENVD
AELLQEFEQRQSGVAAGGDAPPPPPVAG*

5'UTR

chr03:1818839..1818855 (- strand) : 17 bp

CDS

chr03:1817672..1818838 (- strand) : 1167 bp

3'UTR

chr03:1817533..1817671 (- strand) : 139 bp

FASTA

>Os03t0131900-01 class=Sequence position=chr03:1817533..1818855 (- strand)
AAGCTCCTCC CACTCCAATG GAGGCTGTCC TACGACACCC ATCCCTTTCC CGCCTCAAAC CCCCCAACCC CAATGCTCAG
AGAACTCCAG CCCTCTCCAT CACCGTCCCT TTCCGGCTTC GTCTCCCCAA CCGGCGGCTC ACCGCCGCGG CGGTGTTCCA
GGACCAGACC AACCCAAGAA ACCCAGCGAG CAAGGGAGGC GACGACGATG AGGCGTACGG CGAGGTGGAC CGTATTGTGT
CCAGCCGCAC CATCAAGAAT CCGGTGTTCG CGGAGGACGG CTCGGCCACC ACGGTCACCG CCACGGAGTA CCTCGTCGAG
TGGAAGGACG GGCACGAGCC TTCGTGGATC CCGGCGGAGG CCATAGCGGC GGACGTGGTG GCGGAGTACG AGACGCCGTG
GTGGACGGCC GCCAAGAAGG CGGACGCGGC GGAGATCACT GCGCTACTCG CGGACGAGAC GCTGCGGCGT GACCCCGACG
CGGAGGATGC GCAGGGGCGC ACGGCGATGC ACTTCGCCGC GGGGCTTGGA TCCGAGGAGT GCGTGCGCGC GCTCGCCGAG
GCCGGGGCCG ACGTGGGGCG ACCCGAGCGC GCCGGCGGCG GGCTCACGCC GCTGCACATC GCGGTCGGGT ACGGGCGCCC
GGCGGCCGTG CGCGCGCTGC TGGAGCTGGG CGCCGAGCCG GAGGCCCCCG ACGGGCAGGG CCGGACGCCG CTGGAGCTGG
TCCAGGACGT GCTCGCGAAG ACGCCCAAGG GCAACCCGGC GACGTTCGAG CGGCGGCTGG CGCTGGAGGC GGCGGCGAAG
GAGCTGGAGA AGGCCGTGTA CGAGTGGGGC GAAGTGGAGA AGGTGGTGGA CGGCCGCGGC GAGGGCAAGT GGCGGGAGTA
CTTGGTGGAG TGGCGCGACG GCGGCGACAG GGAGTGGGTG AGGGCGGCGT GGGTGGCGGA GGACCTGGTG AAGGACTTCG
ACGCCGGGCT GGAGTACGCC GTCGCGGAGG CCGTCGTCAA CAAGAGGGAG GCGGCGGAAG GGGAGGGGAA ATGGGAGTAC
CTTGTCAAGT GGGTGGACAT CGAGGAGGCG ACGTGGGAGC CCGCGGAGAA CGTCGACGCC GAACTCCTCC AGGAGTTCGA
GCAGCGGCAA TCTGGGGTGG CTGCTGGCGG TGATGCTCCG CCGCCGCCGC CGGTCGCCGG GTGACAGCGT GTCGCCGTCG
ACGGAGGGTG TTCGATTCTT CCTGGTTTTG CTGTGTTTAA CAGAACGGGA TAAAATGTTT GTGCTGCTGC AAAATGTATC
ATTAGCGCTT TGATAATTTT TGAGTTGAGC AGAACTTTAA CCT

Locus: Os03g0131900

Loading...

Locus: Os03g0131900

Loading...