Os03t0135700-01

Locus

Os03g0135700

Description

Basic helix-loop-helix transcription factor, Nucleotide-binding site leucine-rich repeat (NLR) protein-mediated resistance to rice blast disease

RAP-DB Gene Symbol Synonym(s)

RAI1

RAP-DB Gene Name Synonym(s)

Rac Immunity1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

RAI1, OsbHLH003

Oryzabase Gene Name Synonym(s)

Rac Immunity1, Rac Immunity 1, basic helix-loop-helix protein 003

Transcript Evidence

AK103779

Protein Evidence

Q10S44

Literature

PMID: 30919975

PMID: 22437844

Note

Manual Curation

May 16, 2019

Gene Ontology (GO)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

Helix-loop-helix DNA-binding domain superfamily (IPR036638)

Myc-type, basic helix-loop-helix (bHLH) domain (IPR011598)

Full-length cDNA

J033145C17 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0135700-01)

RiceXPro (AK103779)

Others

Oryzabase (10918)

KEGG (Os03t0135700-01)

Transcript

1467 bp

>Os03t0135700-01 Basic helix-loop-helix transcription factor, Nucleotide-binding site leucine-rich repeat (NLR) protein-mediated resistance to rice blast disease
GGAGAGGTGACTGCTAGCGAGGAAAGGGAGCATATATACTACTATAGCTTAGCTTGCTGC
AGGTGCTAGCTAGCTGAGGCATGGAGCTTGACGAGGAGTCCTTCTTGGATGAGCTCATGT
CGCTGCGGCGTGATGGATCGGCGCCGTGGCAGGCGCCGCCGTACCCGGGTGGCGGCGGCG
GCGGCGGCGGTGGCGGCATGATGATGAGTGACCTCCTCTTCTACGGCGGCGACGGCGGCA
GCGCGGAGGCGAGGGGCGGGATGGACGCGTCGCCGTTCCAGGAGCTGGCGTCCATGGCGG
CGCCGCCGCCTCAGCATCCGCACGAGGAGTTCAACTTCGACTGCTTGAGCGAGGTCTGCA
ACCCGTACCGCAGCTGCGGCGCCCAGCTCGTCCCCTCGGAGGCGGCTAGCCAGACGCAGA
CGCAGCTCACTCCTCTCCGCGACGCAATGGTGGCGGAGGAGGAGACGAGCGGCGACAAGG
CGCTGCTCCATGGCGGCGGCGGCTCGTCGTCGCCGACGTTCATGTTTGGAGGTGGCGCCG
GAGAGAGCTCGGAGATGATGGCCGGCATCAGAGGCGTCGGCGGCGGCGTCCACCCGCGGA
GCAAGCTCCACGGCACGCCGTCGAAGAACCTCATGGCCGAGAGGCGGCGTCGCAAGCGGC
TCAACGACCGGCTGTCCATGCTCCGGTCCATCGTGCCCAAGATTAGCAAGATGGACAGGA
CCTCGATCCTTGGTGACACCATCGACTACGTGAAGGAGCTGACGGAGAGGATCAAAACCC
TCGAGGAGGAGATCGGCGTCACGCCGGAGGAGCTCGACCTGTTGAACACGATGAAGGATT
CCTCCAGCGGCAACAACAACGAGATGCTCGTGAGGAATTCCACCAAGTTCGATGTCGAGA
ACCGGGGCAGCGGGAACACGAGGATCGAGATATGCTGCCCGGCGAACCCCGGCGTGCTGC
TGTCGACGGTGAGCGCGCTGGAGGTGCTGGGGCTAGAGATCGAGCAGTGCGTCGTGAGCT
GCTTCAGTGACTTTGGCATGCAGGCCTCCTGCTTACAAGAGGACGGGAAGAGGCAAGTTG
TCAGCACCGACGAGATCAAGCAGACATTGTTCAGGAGCGCAGGCTATGGCGGAAGGTGTC
TGTAGCTAGCTAGCTATACAATCCATTGAACGCTGAGCACTGTGAGCAGGTACAGGTTGC
ATATATATGATCTTCATCATCCATGATATAGGAGTAATAGCTATACATGCATATGCACTT
CGCTCCAGGAATTATAGTAGATCGAGTACCATTTATGAGTTCATATTCATCAGCAGTGGT
AGTACCTCGTTTCTGAACACACCAGAGAGCAAATTAAAGATTTGCTCAAGTATTGTAAGC
TTTGCATTTGTGAATCGGTATGGGAACCGGCCGTGTGATTTGTCGAACATTGGATTTGAA
TTAAACGCCAAGGTACCAATTGTTTGT

CDS

1065 bp

>Os03t0135700-01 Basic helix-loop-helix transcription factor, Nucleotide-binding site leucine-rich repeat (NLR) protein-mediated resistance to rice blast disease
ATGGAGCTTGACGAGGAGTCCTTCTTGGATGAGCTCATGTCGCTGCGGCGTGATGGATCG
GCGCCGTGGCAGGCGCCGCCGTACCCGGGTGGCGGCGGCGGCGGCGGCGGTGGCGGCATG
ATGATGAGTGACCTCCTCTTCTACGGCGGCGACGGCGGCAGCGCGGAGGCGAGGGGCGGG
ATGGACGCGTCGCCGTTCCAGGAGCTGGCGTCCATGGCGGCGCCGCCGCCTCAGCATCCG
CACGAGGAGTTCAACTTCGACTGCTTGAGCGAGGTCTGCAACCCGTACCGCAGCTGCGGC
GCCCAGCTCGTCCCCTCGGAGGCGGCTAGCCAGACGCAGACGCAGCTCACTCCTCTCCGC
GACGCAATGGTGGCGGAGGAGGAGACGAGCGGCGACAAGGCGCTGCTCCATGGCGGCGGC
GGCTCGTCGTCGCCGACGTTCATGTTTGGAGGTGGCGCCGGAGAGAGCTCGGAGATGATG
GCCGGCATCAGAGGCGTCGGCGGCGGCGTCCACCCGCGGAGCAAGCTCCACGGCACGCCG
TCGAAGAACCTCATGGCCGAGAGGCGGCGTCGCAAGCGGCTCAACGACCGGCTGTCCATG
CTCCGGTCCATCGTGCCCAAGATTAGCAAGATGGACAGGACCTCGATCCTTGGTGACACC
ATCGACTACGTGAAGGAGCTGACGGAGAGGATCAAAACCCTCGAGGAGGAGATCGGCGTC
ACGCCGGAGGAGCTCGACCTGTTGAACACGATGAAGGATTCCTCCAGCGGCAACAACAAC
GAGATGCTCGTGAGGAATTCCACCAAGTTCGATGTCGAGAACCGGGGCAGCGGGAACACG
AGGATCGAGATATGCTGCCCGGCGAACCCCGGCGTGCTGCTGTCGACGGTGAGCGCGCTG
GAGGTGCTGGGGCTAGAGATCGAGCAGTGCGTCGTGAGCTGCTTCAGTGACTTTGGCATG
CAGGCCTCCTGCTTACAAGAGGACGGGAAGAGGCAAGTTGTCAGCACCGACGAGATCAAG
CAGACATTGTTCAGGAGCGCAGGCTATGGCGGAAGGTGTCTGTAG

Protein

355 aa

>Os03t0135700-01 Basic helix-loop-helix transcription factor, Nucleotide-binding site leucine-rich repeat (NLR) protein-mediated resistance to rice blast disease
MELDEESFLDELMSLRRDGSAPWQAPPYPGGGGGGGGGGMMMSDLLFYGGDGGSAEARGG
MDASPFQELASMAAPPPQHPHEEFNFDCLSEVCNPYRSCGAQLVPSEAASQTQTQLTPLR
DAMVAEEETSGDKALLHGGGGSSSPTFMFGGGAGESSEMMAGIRGVGGGVHPRSKLHGTP
SKNLMAERRRRKRLNDRLSMLRSIVPKISKMDRTSILGDTIDYVKELTERIKTLEEEIGV
TPEELDLLNTMKDSSSGNNNEMLVRNSTKFDVENRGSGNTRIEICCPANPGVLLSTVSAL
EVLGLEIEQCVVSCFSDFGMQASCLQEDGKRQVVSTDEIKQTLFRSAGYGGRCL*

5'UTR

chr03:1985484..1985563 (- strand) : 80 bp

CDS

chr03:1984854..1985483 (- strand) : 630 bp

chr03:1984535..1984711 (- strand) : 177 bp

chr03:1984180..1984350 (- strand) : 171 bp

chr03:1983888..1983974 (- strand) : 87 bp

3'UTR

chr03:1983566..1983887 (- strand) : 322 bp

FASTA

>Os03t0135700-01 class=Sequence position=chr03:1983566..1985563 (- strand)
GGAGAGGTGA CTGCTAGCGA GGAAAGGGAG CATATATACT ACTATAGCTT AGCTTGCTGC AGGTGCTAGC TAGCTGAGGC
ATGGAGCTTG ACGAGGAGTC CTTCTTGGAT GAGCTCATGT CGCTGCGGCG TGATGGATCG GCGCCGTGGC AGGCGCCGCC
GTACCCGGGT GGCGGCGGCG GCGGCGGCGG TGGCGGCATG ATGATGAGTG ACCTCCTCTT CTACGGCGGC GACGGCGGCA
GCGCGGAGGC GAGGGGCGGG ATGGACGCGT CGCCGTTCCA GGAGCTGGCG TCCATGGCGG CGCCGCCGCC TCAGCATCCG
CACGAGGAGT TCAACTTCGA CTGCTTGAGC GAGGTCTGCA ACCCGTACCG CAGCTGCGGC GCCCAGCTCG TCCCCTCGGA
GGCGGCTAGC CAGACGCAGA CGCAGCTCAC TCCTCTCCGC GACGCAATGG TGGCGGAGGA GGAGACGAGC GGCGACAAGG
CGCTGCTCCA TGGCGGCGGC GGCTCGTCGT CGCCGACGTT CATGTTTGGA GGTGGCGCCG GAGAGAGCTC GGAGATGATG
GCCGGCATCA GAGGCGTCGG CGGCGGCGTC CACCCGCGGA GCAAGCTCCA CGGCACGCCG TCGAAGAACC TCATGGCCGA
GAGGCGGCGT CGCAAGCGGC TCAACGACCG GCTGTCCATG CTCCGGTCCA TCGTGCCCAA GATTAGCAAG GTGACACACA
CATTGATTTG TATTGTTGTC TTGTGACCTA ATTAATTGAC CTAGCTAGCT GTAGCTAGCT TCTTGTCTCC GTGTCCCGTG
TGCTCATATA TCTGTAATTA AACAATCAAT CAATCGCTCG CTCGCGCTGC AGATGGACAG GACCTCGATC CTTGGTGACA
CCATCGACTA CGTGAAGGAG CTGACGGAGA GGATCAAAAC CCTCGAGGAG GAGATCGGCG TCACGCCGGA GGAGCTCGAC
CTGTTGAACA CGATGAAGGA TTCCTCCAGC GGCAACAACA ACGAGATGCT CGTGAGGAAT TCCACCAAGG TACGTACCTA
GCTTAGCTAC GCAGGCAAGC ATCGCATCGA TGGAGTTTTA GTTTGGCATG TATGTATGTG CTTGTATATT TCTTGTGCGT
CCGCGCAGCT AAATTAATCT GGTTGTTGCG ATCGAACTTT GTGATGCATG GGGCGAAACT AACTAATTAA ACTGCGGTTT
GATTTTCCTC CAGTTCGATG TCGAGAACCG GGGCAGCGGG AACACGAGGA TCGAGATATG CTGCCCGGCG AACCCCGGCG
TGCTGCTGTC GACGGTGAGC GCGCTGGAGG TGCTGGGGCT AGAGATCGAG CAGTGCGTCG TGAGCTGCTT CAGTGACTTT
GGCATGCAGG CCTCCTGCTT ACAAGTAAGT TCTATATATC TATCTTGAAT TCTTGATAGC TATAGCAACT TAGCTAGTGC
GGATTTCTGA ACATCTATAT CGGTCGATAT ATAGCTATAC CTTGATTTCT TGCTCGAACA AATTAACCTA TAGCTATATA
TAGGCATATA TATGTTTTGA TTAATCTCTT GTTTCAATAT TGAATGGGTT CGTCGACAAT GCATGATAGG AGGACGGGAA
GAGGCAAGTT GTCAGCACCG ACGAGATCAA GCAGACATTG TTCAGGAGCG CAGGCTATGG CGGAAGGTGT CTGTAGCTAG
CTAGCTATAC AATCCATTGA ACGCTGAGCA CTGTGAGCAG GTACAGGTTG CATATATATG ATCTTCATCA TCCATGATAT
AGGAGTAATA GCTATACATG CATATGCACT TCGCTCCAGG AATTATAGTA GATCGAGTAC CATTTATGAG TTCATATTCA
TCAGCAGTGG TAGTACCTCG TTTCTGAACA CACCAGAGAG CAAATTAAAG ATTTGCTCAA GTATTGTAAG CTTTGCATTT
GTGAATCGGT ATGGGAACCG GCCGTGTGAT TTGTCGAACA TTGGATTTGA ATTAAACGCC AAGGTACCAA TTGTTTGT