Os03t0135700-02

Locus

Os03g0135700

Description

Transcriptional activator Rb homolog (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsRAI1, RAI1, OsbHLH003, bHLH003, bHLH3

Oryzabase Gene Name Synonym(s)

Rac Immunity1, Rac Immunity 1, basic helix-loop-helix protein 003

Transcript Evidence

AK060029 (DDBJ, Best hit)

Protein Evidence

F1DK91 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Helix-loop-helix DNA-binding (IPR011598)

Full-length cDNA

006-303-F08 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0135700-02)

RiceXPro (AK060029)

Others

Oryzabase (10918)

KEGG (Os03t0135700-02)

Transcript

1382 bp

>Os03t0135700-02 Transcriptional activator Rb homolog (Fragment).
AGGTGCTAGCTAGCTGAGGCATGGAGCTTGACGAGGAGTCCTTCTTGGATGAGCTCATGT
CGCTGCGGCGTGATGGATCGGCGCCGTGGCAGGCGCCGCCGTACCCGGGTGGCGGCGGCG
GCGGCGGCGGTGGCGGCATGATGATGAGTGACCTCCTCTTCTACGGCGGCGACGGCGGCA
GCGCGGAGGCGAGGGGCGGGATGGACGCGTCGCCGTTCCAGGAGCTGGCGTCCATGGCGG
CGCCGCCGCCTCAGCATCCGCACGAGGAGTTCAACTTCGACTGCTTGAGCGAGGTCTGCA
ACCCGTACCGCAGCTGCGGCGCCCAGCTCGTCCCCTCGGAGGCGGCTAGCCAGACGCAGA
CGCAGCTCACTCCTCTCCGCGACGCAATGGTGGCGGAGGAGGAGACGAGCGGCGACAAGG
CGCTGCTCCATGGCGGCGGCGGCTCGTCGTCGCCGACGTTCATGTTTGGAGGTGGCGCCG
GAGAGAGCTCGGAGATGATGGCCGGCATCAGAGGCGTCGGCGGCGGCGTCCACCCGCGGA
GCAAGCTCCACGGCACGCCGTCGAAGAACCTCATGGCCGAGAGGCGGCGTCGCAAGCGGC
TCAACGACCGGCTGTCCATGCTCCGGTCCATCGTGCCCAAGATTAGCAAGATGGACAGGA
CCTCGATCCTTGGTGACACCATCGACTACGTGAAGGAGCTGACGGAGAGGATCAAAACCC
TCGAGGAGGAGATCGGCGTCACGCCGGAGGAGCTCGACCTGTTGAACACGATGAAGGATT
CCTCCAGCGGCAACAACAACGAGATGCTCGTGAGGAATTCCACCAAGTTCGATGTCGAGA
ACCGGGGCAGCGGGAACACGAGGATCGAGATATGCTGCCCGGCGAACCCCGGCGTGCTGC
TGTCGACGGTGAGCGCGCTGGAGGTGCTGGGGCTAGAGATCGAGCAGTGCGTCGTGAGCT
GCTTCAGTGACTTTGGCATGCAGGCCTCCTGCTTACAAGAGGACGGGAAGAGGCAAGTTG
TCAGCACCGACGAGATCAAGCAGACATTGTTCAGGAGCGCAGGCTATGGCGGAAGGTGTC
TGTAGCTAGCTAGCTATACAATCCATTGAACGCTGAGCACTGTGAGCAGGTACAGGTTGC
ATATATATGATCTTCATCATCCATGATATAGGAGTAATAGCTATACATGCATATGCACTT
CGCTCCAGGAATTATAGTAGATCGAGTACCATTTATGAGTTCATATTCATCAGCAGTGGT
AGTACCTCGTTTCTGAACACACCAGAGAGCAAATTAAAGATTTGCTCAAGTATTGTAAGC
TTTGCATTTGTGAATCGGTATGGGAACCGGCCGTGTGATTTGTCGAACATTGGATTTGAA
TT

CDS

1065 bp

>Os03t0135700-02 Transcriptional activator Rb homolog (Fragment).
ATGGAGCTTGACGAGGAGTCCTTCTTGGATGAGCTCATGTCGCTGCGGCGTGATGGATCG
GCGCCGTGGCAGGCGCCGCCGTACCCGGGTGGCGGCGGCGGCGGCGGCGGTGGCGGCATG
ATGATGAGTGACCTCCTCTTCTACGGCGGCGACGGCGGCAGCGCGGAGGCGAGGGGCGGG
ATGGACGCGTCGCCGTTCCAGGAGCTGGCGTCCATGGCGGCGCCGCCGCCTCAGCATCCG
CACGAGGAGTTCAACTTCGACTGCTTGAGCGAGGTCTGCAACCCGTACCGCAGCTGCGGC
GCCCAGCTCGTCCCCTCGGAGGCGGCTAGCCAGACGCAGACGCAGCTCACTCCTCTCCGC
GACGCAATGGTGGCGGAGGAGGAGACGAGCGGCGACAAGGCGCTGCTCCATGGCGGCGGC
GGCTCGTCGTCGCCGACGTTCATGTTTGGAGGTGGCGCCGGAGAGAGCTCGGAGATGATG
GCCGGCATCAGAGGCGTCGGCGGCGGCGTCCACCCGCGGAGCAAGCTCCACGGCACGCCG
TCGAAGAACCTCATGGCCGAGAGGCGGCGTCGCAAGCGGCTCAACGACCGGCTGTCCATG
CTCCGGTCCATCGTGCCCAAGATTAGCAAGATGGACAGGACCTCGATCCTTGGTGACACC
ATCGACTACGTGAAGGAGCTGACGGAGAGGATCAAAACCCTCGAGGAGGAGATCGGCGTC
ACGCCGGAGGAGCTCGACCTGTTGAACACGATGAAGGATTCCTCCAGCGGCAACAACAAC
GAGATGCTCGTGAGGAATTCCACCAAGTTCGATGTCGAGAACCGGGGCAGCGGGAACACG
AGGATCGAGATATGCTGCCCGGCGAACCCCGGCGTGCTGCTGTCGACGGTGAGCGCGCTG
GAGGTGCTGGGGCTAGAGATCGAGCAGTGCGTCGTGAGCTGCTTCAGTGACTTTGGCATG
CAGGCCTCCTGCTTACAAGAGGACGGGAAGAGGCAAGTTGTCAGCACCGACGAGATCAAG
CAGACATTGTTCAGGAGCGCAGGCTATGGCGGAAGGTGTCTGTAG

Protein

355 aa

>Os03t0135700-02 Transcriptional activator Rb homolog (Fragment).
MELDEESFLDELMSLRRDGSAPWQAPPYPGGGGGGGGGGMMMSDLLFYGGDGGSAEARGG
MDASPFQELASMAAPPPQHPHEEFNFDCLSEVCNPYRSCGAQLVPSEAASQTQTQLTPLR
DAMVAEEETSGDKALLHGGGGSSSPTFMFGGGAGESSEMMAGIRGVGGGVHPRSKLHGTP
SKNLMAERRRRKRLNDRLSMLRSIVPKISKMDRTSILGDTIDYVKELTERIKTLEEEIGV
TPEELDLLNTMKDSSSGNNNEMLVRNSTKFDVENRGSGNTRIEICCPANPGVLLSTVSAL
EVLGLEIEQCVVSCFSDFGMQASCLQEDGKRQVVSTDEIKQTLFRSAGYGGRCL*

5'UTR

chr03:1985484..1985503 (- strand) : 20 bp

CDS

chr03:1984854..1985483 (- strand) : 630 bp

chr03:1984535..1984711 (- strand) : 177 bp

chr03:1984180..1984350 (- strand) : 171 bp

chr03:1983888..1983974 (- strand) : 87 bp

3'UTR

chr03:1983591..1983887 (- strand) : 297 bp

FASTA

>Os03t0135700-02 class=Sequence position=chr03:1983591..1985503 (- strand)
AGGTGCTAGC TAGCTGAGGC ATGGAGCTTG ACGAGGAGTC CTTCTTGGAT GAGCTCATGT CGCTGCGGCG TGATGGATCG
GCGCCGTGGC AGGCGCCGCC GTACCCGGGT GGCGGCGGCG GCGGCGGCGG TGGCGGCATG ATGATGAGTG ACCTCCTCTT
CTACGGCGGC GACGGCGGCA GCGCGGAGGC GAGGGGCGGG ATGGACGCGT CGCCGTTCCA GGAGCTGGCG TCCATGGCGG
CGCCGCCGCC TCAGCATCCG CACGAGGAGT TCAACTTCGA CTGCTTGAGC GAGGTCTGCA ACCCGTACCG CAGCTGCGGC
GCCCAGCTCG TCCCCTCGGA GGCGGCTAGC CAGACGCAGA CGCAGCTCAC TCCTCTCCGC GACGCAATGG TGGCGGAGGA
GGAGACGAGC GGCGACAAGG CGCTGCTCCA TGGCGGCGGC GGCTCGTCGT CGCCGACGTT CATGTTTGGA GGTGGCGCCG
GAGAGAGCTC GGAGATGATG GCCGGCATCA GAGGCGTCGG CGGCGGCGTC CACCCGCGGA GCAAGCTCCA CGGCACGCCG
TCGAAGAACC TCATGGCCGA GAGGCGGCGT CGCAAGCGGC TCAACGACCG GCTGTCCATG CTCCGGTCCA TCGTGCCCAA
GATTAGCAAG GTGACACACA CATTGATTTG TATTGTTGTC TTGTGACCTA ATTAATTGAC CTAGCTAGCT GTAGCTAGCT
TCTTGTCTCC GTGTCCCGTG TGCTCATATA TCTGTAATTA AACAATCAAT CAATCGCTCG CTCGCGCTGC AGATGGACAG
GACCTCGATC CTTGGTGACA CCATCGACTA CGTGAAGGAG CTGACGGAGA GGATCAAAAC CCTCGAGGAG GAGATCGGCG
TCACGCCGGA GGAGCTCGAC CTGTTGAACA CGATGAAGGA TTCCTCCAGC GGCAACAACA ACGAGATGCT CGTGAGGAAT
TCCACCAAGG TACGTACCTA GCTTAGCTAC GCAGGCAAGC ATCGCATCGA TGGAGTTTTA GTTTGGCATG TATGTATGTG
CTTGTATATT TCTTGTGCGT CCGCGCAGCT AAATTAATCT GGTTGTTGCG ATCGAACTTT GTGATGCATG GGGCGAAACT
AACTAATTAA ACTGCGGTTT GATTTTCCTC CAGTTCGATG TCGAGAACCG GGGCAGCGGG AACACGAGGA TCGAGATATG
CTGCCCGGCG AACCCCGGCG TGCTGCTGTC GACGGTGAGC GCGCTGGAGG TGCTGGGGCT AGAGATCGAG CAGTGCGTCG
TGAGCTGCTT CAGTGACTTT GGCATGCAGG CCTCCTGCTT ACAAGTAAGT TCTATATATC TATCTTGAAT TCTTGATAGC
TATAGCAACT TAGCTAGTGC GGATTTCTGA ACATCTATAT CGGTCGATAT ATAGCTATAC CTTGATTTCT TGCTCGAACA
AATTAACCTA TAGCTATATA TAGGCATATA TATGTTTTGA TTAATCTCTT GTTTCAATAT TGAATGGGTT CGTCGACAAT
GCATGATAGG AGGACGGGAA GAGGCAAGTT GTCAGCACCG ACGAGATCAA GCAGACATTG TTCAGGAGCG CAGGCTATGG
CGGAAGGTGT CTGTAGCTAG CTAGCTATAC AATCCATTGA ACGCTGAGCA CTGTGAGCAG GTACAGGTTG CATATATATG
ATCTTCATCA TCCATGATAT AGGAGTAATA GCTATACATG CATATGCACT TCGCTCCAGG AATTATAGTA GATCGAGTAC
CATTTATGAG TTCATATTCA TCAGCAGTGG TAGTACCTCG TTTCTGAACA CACCAGAGAG CAAATTAAAG ATTTGCTCAA
GTATTGTAAG CTTTGCATTT GTGAATCGGT ATGGGAACCG GCCGTGTGAT TTGTCGAACA TTGGATTTGA ATT