Os03t0137800-01

Locus

Os03g0137800

Description

Cyclin-dependent kinase inhibitor family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

KRP5

CGSNL Gene Name

KIP-RELATED PROTEIN 5

Oryzabase Gene Symbol Synonym(s)

OsiICK5, Orysa;KRP5, OrysaICK5, Orysa;ICK5, OsKRP5, OsICK5, ICK5

Oryzabase Gene Name Synonym(s)

Cyclin-dependent kinase inhibitor 5, KIP-related protein 5, inhibitor of cyclin-dependent kinase 5

Transcript Evidence

AK064723 (DDBJ, Best hit)

Protein Evidence

Q283L0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cell cycle arrest (GO:0007050)

Cellular Component: nucleus (GO:0005634)

Molecular Function: cyclin-dependent protein kinase inhibitor activity (GO:0004861)

Functional domain (InterPro)

Cyclin-dependent kinase inhibitor (IPR003175)

Cyclin-dependent kinase inhibitor, plant (IPR016701)

Full-length cDNA

002-118-F09 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0137800-01)

RiceXPro (AK064723)

Others

Oryzabase (12358)

KEGG (Os03t0137800-01)

Transcript

1045 bp

>Os03t0137800-01 Cyclin-dependent kinase inhibitor family protein.
AAACGCGCGCCGTTTCCCGCTTCCACTCCCCTCCCCCCATTATTCCCGCGATTCTCCTCC
CTTCCTCCCGCCGCGCGCGCCTTGGCCATGGGGAAGTACATGCGGAAGGGGAAGGTGTCG
GGGGAGGTGGCGGTGATGGAGGTGGGCGGGGCGCTGCTCGGCGTCCGCACCCGCTCCCGC
ACGCTCGCGCTGCAGCGGACGACCTCGTCGCAGAAGCCGCCGGAGAAGGGGGAGGGGGAC
CCCGGTGCGGGCGCGGGCGCGGGGGCGGAGTACCTCGAGCTCAGGAGCCGGAGGCTCGAG
AAGCCGCCTCCGCACACGCCGCCGGCCAAGGAGAAGGAGACCGCCAGGAGGGCTTCCGCC
GCCGCCGCCGCCGCCGTGAGGATGCCGGCGGCGCCGCAAGCGGCCGAGGAGTTCGAGGCG
GAGGTCGAGGTGTCCTTCGGCGACAACGTTCTTGACCTCGACGGCGACGCCATGGAGAGg
agtaccagggagacaacgccttgcagtttaattaggagctcagaaatgataagcacccct
ggctccacaactaaaaccaacacctcgatcagttcccggcgcagaatggagacctctgtt
tgtcgttacgttccgagttctcttgagatggaagagttctttgcagctgctgaacaacag
caacatcaggctttcagagagaggtataacttctgtcctgtgaacgactgcccacttcct
ggacggtacgaatggacaaggctagactgctagattttcatcttgagagctccattgatc
tctccacacagttgactagcaccaccatggcagaggcaaaatgcaattcgattaggtttc
ttctctgttgtaaaaaaaaaatagagttagtcagtagctcaatgatcttgtgtaacaaac
ataagtgatgttgagttacacatcctgatccccccaccaacatgtaaccgttaactgctc
attctgtaacgaaccACCTCTTTTAGGCCTAGCTTTATTATCTGTCCCCAGTCGATTTAA
TGAATTTAGTTAGAATTTCTCTAGC

CDS

666 bp

>Os03t0137800-01 Cyclin-dependent kinase inhibitor family protein.
ATGGGGAAGTACATGCGGAAGGGGAAGGTGTCGGGGGAGGTGGCGGTGATGGAGGTGGGC
GGGGCGCTGCTCGGCGTCCGCACCCGCTCCCGCACGCTCGCGCTGCAGCGGACGACCTCG
TCGCAGAAGCCGCCGGAGAAGGGGGAGGGGGACCCCGGTGCGGGCGCGGGCGCGGGGGCG
GAGTACCTCGAGCTCAGGAGCCGGAGGCTCGAGAAGCCGCCTCCGCACACGCCGCCGGCC
AAGGAGAAGGAGACCGCCAGGAGGGCTTCCGCCGCCGCCGCCGCCGCCGTGAGGATGCCG
GCGGCGCCGCAAGCGGCCGAGGAGTTCGAGGCGGAGGTCGAGGTGTCCTTCGGCGACAAC
GTTCTTGACCTCGACGGCGACGCCATGGAGAGgagtaccagggagacaacgccttgcagt
ttaattaggagctcagaaatgataagcacccctggctccacaactaaaaccaacacctcg
atcagttcccggcgcagaatggagacctctgtttgtcgttacgttccgagttctcttgag
atggaagagttctttgcagctgctgaacaacagcaacatcaggctttcagagagaggtat
aacttctgtcctgtgaacgactgcccacttcctggacggtacgaatggacaaggctagac
tgctag

Protein

222 aa

>Os03t0137800-01 Cyclin-dependent kinase inhibitor family protein.
MGKYMRKGKVSGEVAVMEVGGALLGVRTRSRTLALQRTTSSQKPPEKGEGDPGAGAGAGA
EYLELRSRRLEKPPPHTPPAKEKETARRASAAAAAAVRMPAAPQAAEEFEAEVEVSFGDN
VLDLDGDAMERSTRETTPCSLIRSSEMISTPGSTTKTNTSISSRRRMETSVCRYVPSSLE
MEEFFAAAEQQQHQAFRERYNFCPVNDCPLPGRYEWTRLDC*

5'UTR

chr03:2088673..2088759 (+ strand) : 87 bp

CDS

chr03:2088760..2089151 (+ strand) : 392 bp

chr03:2090950..2091153 (+ strand) : 204 bp

chr03:2091293..2091362 (+ strand) : 70 bp

3'UTR

chr03:2091363..2091654 (+ strand) : 292 bp

FASTA

>Os03t0137800-01 class=Sequence position=chr03:2088673..2091654 (+ strand)
AAACGCGCGC CGTTTCCCGC TTCCACTCCC CTCCCCCCAT TATTCCCGCG ATTCTCCTCC CTTCCTCCCG CCGCGCGCGC
CTTGGCCATG GGGAAGTACA TGCGGAAGGG GAAGGTGTCG GGGGAGGTGG CGGTGATGGA GGTGGGCGGG GCGCTGCTCG
GCGTCCGCAC CCGCTCCCGC ACGCTCGCGC TGCAGCGGAC GACCTCGTCG CAGAAGCCGC CGGAGAAGGG GGAGGGGGAC
CCCGGTGCGG GCGCGGGCGC GGGGGCGGAG TACCTCGAGC TCAGGAGCCG GAGGCTCGAG AAGCCGCCTC CGCACACGCC
GCCGGCCAAG GAGAAGGAGA CCGCCAGGAG GGCTTCCGCC GCCGCCGCCG CCGCCGTGAG GATGCCGGCG GCGCCGCAAG
CGGCCGAGGA GTTCGAGGCG GAGGTCGAGG TGTCCTTCGG CGACAACGTT CTTGACCTCG ACGGCGACGC CATGGAGAGG
TAAGAGATTT GTTTCTCCCC CCACATCTCT TCTGTTTCCT TTCCTCCTTT TTCTCGGATT CGTTTCTTGT GCTGCGTGGC
CGCGTGGGTT TTGGGGTTTA GGGTTTATCT ATAACCCTGA ACTTCCAACC TAAAATACTT CCTTTGTAAT CCGCGCTGCT
TGGTTTTGAT TCTTTCTACT GCACTTGCGC CGCCGTCTCA TGTCTTTAGG CCTGAGTGAT GCGTGCACGA TTGTTTTCCC
CCCTTTTGCT TCAGTTCTTG TTGCGAAATA TATGAGCCCT AAATACTTTG ATGTCTCTAT GTAGTGAGGT ATTGGTGAAA
TTACTTCGAA GATTTACTTA ATCCTCTACT TGACTTCAAC TCATATTGCA ATGGTTGGAG AGGCTAGACT TCGTTGGACC
AAGCAATGGA CTCCAAGAAT CAGTTTGTTC TAGAAAACTA CTGTGCATTT CAAGCCCCAA TTAAAATGGT GTTGCTTGCG
CCTAATGATG ACTCGCTTAT TAGTGGAGTC TCCTCTTCCT CTTCTCCGGT GGCCGTGGCC TCGTCTTTTT CCATAGTGGA
AGGGGAAAGT TGCCTCCTTT CCCCTTTCTC CTATAGCCGC ACTTTGTTTT TTGCACTGGT CTCTCTAGTT GGGGCTTGTG
GCTTGGTTGG TGGTGGTGGT GGTGGTGGGG CTAGCAGGCA GGGACCTCAT CTCCCAATCG TTTAGATATC GAGAGCCTCA
TCTTCTTCCC TTTTGCAAGA AATTTCAATC GCCCCATCAT CCTCAAAGGC ACCACAGCTG TCGCACTCAA GATCCCATTT
CTAGCTTGGT TGCTTGCTCA CTTGCTAGTT GGTACTCTAC TACGAGCCAT GTGTCTCCCA GAAGGCAAGT AAATGGCCAT
GGCATTAGCA AAGCTGCTGC CCATCATTAG CCATTTACCA GAGGAGTGTC ATCAACATTG AATGCTTCCA GTCTTCTTGG
CTGTATGGGA GCATTGGTCC TTGAATGGAC CACCCACCTC TCTTCAAATG TTGAGGTGAA ATGGAGTTCC CTCAACCGAA
AATTTTTATC TTTAACTCAG CCTTTGCAAT TAACCCTTGA TTCTTCTTTT AAAAGAAGAA GAAAAAGGAA CACAGCTTTA
CTAGTAGTTG CTGGTTAATC CGGCACTCAA GCTTAAATGC TTCTTTTGAC AAATTTTCAG TGTCACCGTG CAATCTTAAC
TATTTTTAGT CGTATATTCT TGTTTATGTG GTCCTTTTCG CCGGCATATA CATGTTGAAA AACGCTATTT ACTTCACTTG
GCTCTGTTAG GCCCAGTGGT TGTTTGTCCG TACTTAGTGT GCTACACCAA CAATCAAGTA CCACCTCATT GTGGGGGCAT
TTGCTAGGAA GAGACAAGAG CTTGATAAAC GAGAAATGAA CCGTTTGTGC TCGATCGATT GTCATCTGTT GTCATCTCAT
TTCACCAACA CAGCTTGCAT TTTTGAAGAG ACACGTTTCA AGATCTGAAG CACTTGGTAT AGGGATGCTG GCTGGAATCT
ACTGTCGTCC AAAGCTGAAT GTTGATTAGT CTGTCTACAG TTCTGTTCCT CTGATAGTGG GTACCCTGGC ATTTGAAAAT
GTTTGTCTTC AGTGCAGCAG GTTTATGTGG CCAAGTTAGC GTTAGCTCAA TTTCCTTAAT TTTGTCGGCT CTGCCTCTGC
TTTGGTTTTT AAACCTATAA CAAGAATGGA AAATGTACTT GTTAGATTCT TGTGTATTTC TGCCTCTGAA CTCAATCTTT
TTCGAGCTAT TTGTTCATAT TCTGCTAttg cttgcaggag taccagggag acaacgcctt gcagtttaat taggagctca
gaaatgataa gcacccctgg ctccacaact aaaaccaaca cctcgatcag ttcccggcgc agaatggaga cctctgtttg
tcgttacgtt ccgagttctc ttgagatgga agagttcttt gcagctgctg aacaacagca acatcaggct ttcagagaga
ggtaaggact ttgttctcat ttttttttca cttgcacaat ttgctaattt gatttttttg ttcttgatag tacagttatt
ggtgattatt gttataatga aatacatttg ctaacgttga atattctctg ttctaatcag gtataacttc tgtcctgtga
acgactgccc acttcctgga cggtacgaat ggacaaggct agactgctag attttcatct tgagagctcc attgatctct
ccacacagtt gactagcacc accatggcag aggcaaaatg caattcgatt aggtttcttc tctgttgtaa aaaaaaaata
gagttagtca gtagctcaat gatcttgtgt aacaaacata agtgatgttg agttacacat cctgatcccc ccaccaacat
gtaaccgtta actgctcatt ctgtaacgaa ccACCTCTTT TAGGCCTAGC TTTATTATCT GTCCCCAGTC GATTTAATGA
ATTTAGTTAG AATTTCTCTA GC

Locus: Os03g0137800

Loading...

Locus: Os03g0137800

Loading...