Os03t0142500-01

Locus

Os03g0142500

Description

Zinc finger, RING/FYVE/PHD-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsRFPH2-9

Oryzabase Gene Name Synonym(s)

RING finger protein OsRFPH2-9, RING-H2 protein 9

Transcript Evidence

AK100238 (DDBJ, Best hit)

Protein Evidence

NP_001148048.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, RING-type (IPR001841)

von Willebrand factor, type A (IPR002035)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, C3HC4 RING-type (IPR018957)

Full-length cDNA

J023052J15 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0142500-01)

RiceXPro (AK100238)

Others

Oryzabase (11770)

KEGG (Os03t0142500-01)

Transcript

2682 bp

>Os03t0142500-01 Zinc finger, RING/FYVE/PHD-type domain containing protein.
GTTCGCGTTCATCTTCTGCTTGTTATAATCCTCCATTCTTTTTGCTCTTCCTCGCACTCG
CAGCGCCACCAACGAAAACCCAAGGCAACGCACCACGCTGCACGCGTCCGTGGTCGCCGC
GAAACTTGCGCCGCGATGGGGAGGCCGATTCACCCCCAAATCCTGCCATCCTGATCCAGT
TTGATTTCTCCGTCGAGCAGCAACAGCAGCAGCGAGGATTGGGTGTGCGAAAAGGAGTCG
CCTTTGAGGGATCGTGAGCAATGGCGCCGGCGTGGGATCGCGCCAAGCACGCGCTCGCCA
CCAGGCTCTGCATTCGCTTCCCGGCGCGGCAGAGGGCCGTGGAGGATGCACCGGCGGAAG
ACGAGGCGCCTCCGCCGCCTGCGGCGGCGGCGGCGCGTGCTGTGCCGGAGGAGAAGTTGA
AGTCGCCATCGGTGTCCGTGCGGCGGCTTTCGAGCTCTGGGAGCTGGGGCAAGAAGAAGG
TATGTGCCATTTGCCTTGGTGGCATACGGACAGGAGGACAGGCCTTGTTCACAGCTGAAT
GCTCCCACGAATTCCATTTTCATTGCATCTCCTCAAATGTCAACCATGGCAATTACGTCT
GCCCGGTATGTCGTGCTGAGTGGAAAGAACTTCCCTTCCAAGGAACTCAACCTGGAGACA
CTGCTTATGGACGAGCTAGAGTAAGCACTGTAAATTGGCCCCAGGATGAGGGGCAGATGT
CTGTTGTCCGCAGGCTTTCCCACGGATATAGTGGAAACCTTCAACAGCAACTTGCTGTCT
TCCGTACTCCAGAGGCAAGCATTTTCAATGATGATGAGAACATTGATCCTCAGTCTGAAA
CAGTTGATGATCATAATGCAGTTACTAATTCAGTTGAGATCAAGACATATTCAGAATTTC
CAGCCATACAAAAATCAGAAAGACGGAAGGTCTTTGCTATCTTAATACATCTGAAGGCTC
CAAAGTCCTTGGACTCGGTGAGCTCCCGTGCACCTCTTGACCTTGTGACTGTGCTTGATG
TCAGTGGCAGCATGTCGGGGATAAAACTTTCACTTCTTAAGCGTGCCATGAGTTTTGTCA
TCCAAACACTTGGACCCAATGACCGCCTGTCTGTTGTAGCCTTTTCATCTACAGCACAGA
GGCTCTTTCCACTTCGCCGAATGACCTTAACTGGTCGGCAGCAAGCCTTGCAAGCCATTA
GTTCCCTTGTCGCAAGTGGTGGCACAAACATTGCTGATGCGCTAAAGAAAGGTGCTAAAG
TGGTCAAGGATCGTCGGCGGAAGAATCCTGTTAGCAGCATAATTCTTCTTTCTGATGGTC
AAGACACCCATTCATTTCTATCTGGTGAGGCTGATATAAACTACAGTATACTTGTTCCCC
CTTCAATCCTTCCTGGGACAAGTCATCATGTGCAAATCCACACCTTTGGTTTTGGTACAG
ACCATGATTCGGCTGCCATGCATGCTATTGCTGAGACATCTAATGGCACATTTTCATTTA
TTGATGCTGAAGGCTCAATCCAAGATGCATTTGCTCAATGTATGGGTGGCCTCCTTAGCG
TTGTAGTTAAGGATATGCGGCTGTGCATCGAGTGTATAGATGAAGGCGTGTCTCTTACCT
CCATCAAGTCAGGCAGCTATGCAAGTCAAGTAGCTGGAAATGAACGCAGTGGATTGGTTG
ATATTGGTGACCTCTATGCAGATGAAGAGAGGGGATTTCTGGTCACTCTACATGTCCCAG
CCGCACATGGACAGACTGTGCTGATCAAACCAAAATGCACATACCTAGATGCAATAACTA
TGGAAAATGTCCAGCTAGACGGTGAAGAAGTGATTATTCAGCGTCCTGCATATTGTGTTG
ACTGTACAATGTCACCTGAGGTTGAGCGTGAATGGCACCGTGTTCAAGCCACAGAGGACA
TGTCTGCTGCTCGATCTGCGGCTGAGGATGGCTCTTTCTCTCAGGCCGTGTCAATCCTTG
AAAGCCGTAGGAGAATACTGGAGTTACATGCAGCACACTCTTCAGACAGTCAGTTCTTGG
CATTAATCAAAGAGCTAAGGGAGATGCAGGATAGGGTGGAGAGCCGGCAGAGGTACGAGG
AATCAGGCAGGGCTTACATGCTGTCAGGCCTGAGCTCACACTCATGGCAAAGAGCAACTG
CACGTGGCGACTCGACAGAGCTCACAACCCTTATTAATACTTACCAGACACCATCCATGG
TTGATATGCTACAGCGCTCGCAGACTATCCTGCCCTCTGTTGTCGAAATGCTGAACCGTT
CTTCAACTGTTGCTACTTCAAAGTCCTTCTCTAGCTACCTCCCAACCTCCCGCCATATTG
CTTGATCATAATGTAGTTCTAGCAATAACCAGCCAAGTGTTAGGGAAATGAAGATATCCA
ATTCTTTAGTTTGTTTTCTGCAGATCTTTTTCCATTATTTATAGTGGGCATGGGATTAGA
TTCATTATAAATGTTTGGGTATATACTCTAGTTTGGTGTACATGGGTAAACTTTGAAAGG
GAATGATAAACAGCATAGCTGAAACAGGTGAAAGGAATGCTGACATTTCATTTGTTTCTC
ATCATCATTTTATATTAATTCTCATTTTGTACATAAAATTCTCCCTTGGGTTGTTCCAGG
ATGCTTGTAAGCTCTTGGCTGCATTCACACTTTCGATTGGTT

CDS

2085 bp

>Os03t0142500-01 Zinc finger, RING/FYVE/PHD-type domain containing protein.
ATGGCGCCGGCGTGGGATCGCGCCAAGCACGCGCTCGCCACCAGGCTCTGCATTCGCTTC
CCGGCGCGGCAGAGGGCCGTGGAGGATGCACCGGCGGAAGACGAGGCGCCTCCGCCGCCT
GCGGCGGCGGCGGCGCGTGCTGTGCCGGAGGAGAAGTTGAAGTCGCCATCGGTGTCCGTG
CGGCGGCTTTCGAGCTCTGGGAGCTGGGGCAAGAAGAAGGTATGTGCCATTTGCCTTGGT
GGCATACGGACAGGAGGACAGGCCTTGTTCACAGCTGAATGCTCCCACGAATTCCATTTT
CATTGCATCTCCTCAAATGTCAACCATGGCAATTACGTCTGCCCGGTATGTCGTGCTGAG
TGGAAAGAACTTCCCTTCCAAGGAACTCAACCTGGAGACACTGCTTATGGACGAGCTAGA
GTAAGCACTGTAAATTGGCCCCAGGATGAGGGGCAGATGTCTGTTGTCCGCAGGCTTTCC
CACGGATATAGTGGAAACCTTCAACAGCAACTTGCTGTCTTCCGTACTCCAGAGGCAAGC
ATTTTCAATGATGATGAGAACATTGATCCTCAGTCTGAAACAGTTGATGATCATAATGCA
GTTACTAATTCAGTTGAGATCAAGACATATTCAGAATTTCCAGCCATACAAAAATCAGAA
AGACGGAAGGTCTTTGCTATCTTAATACATCTGAAGGCTCCAAAGTCCTTGGACTCGGTG
AGCTCCCGTGCACCTCTTGACCTTGTGACTGTGCTTGATGTCAGTGGCAGCATGTCGGGG
ATAAAACTTTCACTTCTTAAGCGTGCCATGAGTTTTGTCATCCAAACACTTGGACCCAAT
GACCGCCTGTCTGTTGTAGCCTTTTCATCTACAGCACAGAGGCTCTTTCCACTTCGCCGA
ATGACCTTAACTGGTCGGCAGCAAGCCTTGCAAGCCATTAGTTCCCTTGTCGCAAGTGGT
GGCACAAACATTGCTGATGCGCTAAAGAAAGGTGCTAAAGTGGTCAAGGATCGTCGGCGG
AAGAATCCTGTTAGCAGCATAATTCTTCTTTCTGATGGTCAAGACACCCATTCATTTCTA
TCTGGTGAGGCTGATATAAACTACAGTATACTTGTTCCCCCTTCAATCCTTCCTGGGACA
AGTCATCATGTGCAAATCCACACCTTTGGTTTTGGTACAGACCATGATTCGGCTGCCATG
CATGCTATTGCTGAGACATCTAATGGCACATTTTCATTTATTGATGCTGAAGGCTCAATC
CAAGATGCATTTGCTCAATGTATGGGTGGCCTCCTTAGCGTTGTAGTTAAGGATATGCGG
CTGTGCATCGAGTGTATAGATGAAGGCGTGTCTCTTACCTCCATCAAGTCAGGCAGCTAT
GCAAGTCAAGTAGCTGGAAATGAACGCAGTGGATTGGTTGATATTGGTGACCTCTATGCA
GATGAAGAGAGGGGATTTCTGGTCACTCTACATGTCCCAGCCGCACATGGACAGACTGTG
CTGATCAAACCAAAATGCACATACCTAGATGCAATAACTATGGAAAATGTCCAGCTAGAC
GGTGAAGAAGTGATTATTCAGCGTCCTGCATATTGTGTTGACTGTACAATGTCACCTGAG
GTTGAGCGTGAATGGCACCGTGTTCAAGCCACAGAGGACATGTCTGCTGCTCGATCTGCG
GCTGAGGATGGCTCTTTCTCTCAGGCCGTGTCAATCCTTGAAAGCCGTAGGAGAATACTG
GAGTTACATGCAGCACACTCTTCAGACAGTCAGTTCTTGGCATTAATCAAAGAGCTAAGG
GAGATGCAGGATAGGGTGGAGAGCCGGCAGAGGTACGAGGAATCAGGCAGGGCTTACATG
CTGTCAGGCCTGAGCTCACACTCATGGCAAAGAGCAACTGCACGTGGCGACTCGACAGAG
CTCACAACCCTTATTAATACTTACCAGACACCATCCATGGTTGATATGCTACAGCGCTCG
CAGACTATCCTGCCCTCTGTTGTCGAAATGCTGAACCGTTCTTCAACTGTTGCTACTTCA
AAGTCCTTCTCTAGCTACCTCCCAACCTCCCGCCATATTGCTTGA

Protein

695 aa

>Os03t0142500-01 Zinc finger, RING/FYVE/PHD-type domain containing protein.
MAPAWDRAKHALATRLCIRFPARQRAVEDAPAEDEAPPPPAAAAARAVPEEKLKSPSVSV
RRLSSSGSWGKKKVCAICLGGIRTGGQALFTAECSHEFHFHCISSNVNHGNYVCPVCRAE
WKELPFQGTQPGDTAYGRARVSTVNWPQDEGQMSVVRRLSHGYSGNLQQQLAVFRTPEAS
IFNDDENIDPQSETVDDHNAVTNSVEIKTYSEFPAIQKSERRKVFAILIHLKAPKSLDSV
SSRAPLDLVTVLDVSGSMSGIKLSLLKRAMSFVIQTLGPNDRLSVVAFSSTAQRLFPLRR
MTLTGRQQALQAISSLVASGGTNIADALKKGAKVVKDRRRKNPVSSIILLSDGQDTHSFL
SGEADINYSILVPPSILPGTSHHVQIHTFGFGTDHDSAAMHAIAETSNGTFSFIDAEGSI
QDAFAQCMGGLLSVVVKDMRLCIECIDEGVSLTSIKSGSYASQVAGNERSGLVDIGDLYA
DEERGFLVTLHVPAAHGQTVLIKPKCTYLDAITMENVQLDGEEVIIQRPAYCVDCTMSPE
VEREWHRVQATEDMSAARSAAEDGSFSQAVSILESRRRILELHAAHSSDSQFLALIKELR
EMQDRVESRQRYEESGRAYMLSGLSSHSWQRATARGDSTELTTLINTYQTPSMVDMLQRS
QTILPSVVEMLNRSSTVATSKSFSSYLPTSRHIA*

5'UTR

chr03:2336789..2337048 (+ strand) : 260 bp

CDS

chr03:2337049..2337264 (+ strand) : 216 bp

chr03:2339451..2341319 (+ strand) : 1869 bp

3'UTR

chr03:2341320..2341656 (+ strand) : 337 bp

FASTA

>Os03t0142500-01 class=Sequence position=chr03:2336789..2341656 (+ strand)
GTTCGCGTTC ATCTTCTGCT TGTTATAATC CTCCATTCTT TTTGCTCTTC CTCGCACTCG CAGCGCCACC AACGAAAACC
CAAGGCAACG CACCACGCTG CACGCGTCCG TGGTCGCCGC GAAACTTGCG CCGCGATGGG GAGGCCGATT CACCCCCAAA
TCCTGCCATC CTGATCCAGT TTGATTTCTC CGTCGAGCAG CAACAGCAGC AGCGAGGATT GGGTGTGCGA AAAGGAGTCG
CCTTTGAGGG ATCGTGAGCA ATGGCGCCGG CGTGGGATCG CGCCAAGCAC GCGCTCGCCA CCAGGCTCTG CATTCGCTTC
CCGGCGCGGC AGAGGGCCGT GGAGGATGCA CCGGCGGAAG ACGAGGCGCC TCCGCCGCCT GCGGCGGCGG CGGCGCGTGC
TGTGCCGGAG GAGAAGTTGA AGTCGCCATC GGTGTCCGTG CGGCGGCTTT CGAGCTCTGG GAGCTGGGGC AAGAAGGTCA
GGTTTATCTT TCTCACTGGg agagaatata ttctaaacca cttgagtttg atcgacttca acgatttgcc atcgacattg
tctccttcta taatataccg acgactttat taattgttct ataatacgcc attgggctgg gcattctttt caaaaatacc
caaaataccc ttagagacat acaagattaa caattgattt atctcattag aagtttcaaa aaaataaaaa aaatttagtg
gcctcgttac acaacatgga agtttctata catgtttcaa gttttttctg gtatatttag attttagaaa ataatatttt
tatgtggtat atgagagaaa atttgtttac acgagagata atagcacaaa aatatcttat gtagagtatg aaagatgatt
tatattaaaa acatcaataa aatgtatttt atatagcata taacaaatga gttatatatt tttttacaaa aaatataaat
gtaaaaaact tgaaacttct atacaaactt ccatgttgtg taagtaggcc atataatttt ttaaattttt ttttgaaact
tctaatagga taaattaatt ggtaaccttg tatgtacata agggtatttc gggtattttt gaaaatagtg tccagcccaa
tggcgtatta tagaacaatt gataaagtca ctggtatatt atagaaggag acaatatcga tgacaaatcg ttgaactcga
acaaactcag tggtatagaa tagattctct cTTCTGGTAA TGTTAGATTG CGATTGCTCT TGATTTATGG TGTGCAGAGG
TGAGAAAAAG TGTCGGCTTT AATTAATGCA TATTAGATGG TTCTTTTTTG TTGTCAAATA AAACATCGCG AATTTCGGTT
CCATGTTGGT AAAATATCTT CGTAGGGGTT TGACAAGTTC ATTTTTTGTC CTAAAACTAT TGTGGATCAC AATAGCGAGA
GAGAACATTC TTTTTCTGGG TGTCATCTCT TACCTGAAAG GGTAAAATAT CTCTTTATTC TCCACTCCTT TCTAGATATG
TTTAGTTTCC ATTTGAAACT TGCATATGGG CATCGATTTT ATCCGATTTG TCTAAAAATC ATGTAGTTGC GTAAATTCTC
TTTGAGAACA TTTTTTTGAT AAACCTGTAA ATTTGCAATA TATGTAAATA TGGCCACCTC TTTCAAATCG TTCATGTTAA
TACTGTTCCA AATGCTGTAT GTATATTCTT CATTGTTTTG AAGTTTTACT TGAATTTATT GGCACAACGA TCTTTGGCAT
AAATGGCTTC AGACCAGTGC CCGAACAAAG AGAAAGTGTT GCTTCAGCCC ATTGCAGACC AGAACATGCA TTTTGATTGG
TTGGTGGATC ATCTTATCTG ACTTGGTCCC AGTAGTTGTT GAAAATACAA CTTGATTTGT CACATTGACT AATGAAGAAT
ATTTACTTTT TGATGACGGT GCACATGTTT TTAGAACAAC GATACACATG ATGAAATAGC CTTCATTTTT TTTTTGAAAG
ATCACCCCCC CCCCGGGGGG GGGGGGTTAT ATTATAATCA GGTCTTGTGT CATCTATGCT GCAGCTGCAA CTGACCATTC
AGTATTTTAT TACTCCCAAG CTGCACATGC ATACACATTT CAGTGTGTGC ATATTTTTCC AATTCGGAAA CTACCTGTGT
CTATCCAAAT TCCAAATCAT TCCATCCAAA ATGGTTCATC AATCATGAAA ACAAATTGAT CATACTACAC TTGTTATAGG
AAGGTTGGAT TGTAAGCCAT CCCTGCGCTA TTGTCAAAAT GTGTAAATTC TTGTTCTTAA GCTTTGTCCA TGACAAGTTT
ATCGCCATCC TTTTAGTCAT TTGCTCCCTC CTTTTGACAT GTTAAATTTT ATTTTCCTTG GATAGTGGTT CAAAGCCACT
TATCTTTTCT CATTAAGCTG TATCAAGTAT CTACTCTTCA CCTTTACTTG TGTGCTCCTG AGAGATTTTA CATTCGTAAA
TAGTACAGTC ATATGACACA CATATTCCTT TATGTTTCTT TCGTATGACA CATAAATAGG ATAGTCTTTA TGTATATTCA
GGCACAATTT ATAGTTGATA ATGGCAGAAG TTTATGTTAC CATGAAAGCT CTGATGGTAG CAATGCTAAC TTTTTTTTTG
TTGTTTACTC TCTTCATTTC AGAAGGTATG TGCCATTTGC CTTGGTGGCA TACGGACAGG AGGACAGGCC TTGTTCACAG
CTGAATGCTC CCACGAATTC CATTTTCATT GCATCTCCTC AAATGTCAAC CATGGCAATT ACGTCTGCCC GGTATGTCGT
GCTGAGTGGA AAGAACTTCC CTTCCAAGGA ACTCAACCTG GAGACACTGC TTATGGACGA GCTAGAGTAA GCACTGTAAA
TTGGCCCCAG GATGAGGGGC AGATGTCTGT TGTCCGCAGG CTTTCCCACG GATATAGTGG AAACCTTCAA CAGCAACTTG
CTGTCTTCCG TACTCCAGAG GCAAGCATTT TCAATGATGA TGAGAACATT GATCCTCAGT CTGAAACAGT TGATGATCAT
AATGCAGTTA CTAATTCAGT TGAGATCAAG ACATATTCAG AATTTCCAGC CATACAAAAA TCAGAAAGAC GGAAGGTCTT
TGCTATCTTA ATACATCTGA AGGCTCCAAA GTCCTTGGAC TCGGTGAGCT CCCGTGCACC TCTTGACCTT GTGACTGTGC
TTGATGTCAG TGGCAGCATG TCGGGGATAA AACTTTCACT TCTTAAGCGT GCCATGAGTT TTGTCATCCA AACACTTGGA
CCCAATGACC GCCTGTCTGT TGTAGCCTTT TCATCTACAG CACAGAGGCT CTTTCCACTT CGCCGAATGA CCTTAACTGG
TCGGCAGCAA GCCTTGCAAG CCATTAGTTC CCTTGTCGCA AGTGGTGGCA CAAACATTGC TGATGCGCTA AAGAAAGGTG
CTAAAGTGGT CAAGGATCGT CGGCGGAAGA ATCCTGTTAG CAGCATAATT CTTCTTTCTG ATGGTCAAGA CACCCATTCA
TTTCTATCTG GTGAGGCTGA TATAAACTAC AGTATACTTG TTCCCCCTTC AATCCTTCCT GGGACAAGTC ATCATGTGCA
AATCCACACC TTTGGTTTTG GTACAGACCA TGATTCGGCT GCCATGCATG CTATTGCTGA GACATCTAAT GGCACATTTT
CATTTATTGA TGCTGAAGGC TCAATCCAAG ATGCATTTGC TCAATGTATG GGTGGCCTCC TTAGCGTTGT AGTTAAGGAT
ATGCGGCTGT GCATCGAGTG TATAGATGAA GGCGTGTCTC TTACCTCCAT CAAGTCAGGC AGCTATGCAA GTCAAGTAGC
TGGAAATGAA CGCAGTGGAT TGGTTGATAT TGGTGACCTC TATGCAGATG AAGAGAGGGG ATTTCTGGTC ACTCTACATG
TCCCAGCCGC ACATGGACAG ACTGTGCTGA TCAAACCAAA ATGCACATAC CTAGATGCAA TAACTATGGA AAATGTCCAG
CTAGACGGTG AAGAAGTGAT TATTCAGCGT CCTGCATATT GTGTTGACTG TACAATGTCA CCTGAGGTTG AGCGTGAATG
GCACCGTGTT CAAGCCACAG AGGACATGTC TGCTGCTCGA TCTGCGGCTG AGGATGGCTC TTTCTCTCAG GCCGTGTCAA
TCCTTGAAAG CCGTAGGAGA ATACTGGAGT TACATGCAGC ACACTCTTCA GACAGTCAGT TCTTGGCATT AATCAAAGAG
CTAAGGGAGA TGCAGGATAG GGTGGAGAGC CGGCAGAGGT ACGAGGAATC AGGCAGGGCT TACATGCTGT CAGGCCTGAG
CTCACACTCA TGGCAAAGAG CAACTGCACG TGGCGACTCG ACAGAGCTCA CAACCCTTAT TAATACTTAC CAGACACCAT
CCATGGTTGA TATGCTACAG CGCTCGCAGA CTATCCTGCC CTCTGTTGTC GAAATGCTGA ACCGTTCTTC AACTGTTGCT
ACTTCAAAGT CCTTCTCTAG CTACCTCCCA ACCTCCCGCC ATATTGCTTG ATCATAATGT AGTTCTAGCA ATAACCAGCC
AAGTGTTAGG GAAATGAAGA TATCCAATTC TTTAGTTTGT TTTCTGCAGA TCTTTTTCCA TTATTTATAG TGGGCATGGG
ATTAGATTCA TTATAAATGT TTGGGTATAT ACTCTAGTTT GGTGTACATG GGTAAACTTT GAAAGGGAAT GATAAACAGC
ATAGCTGAAA CAGGTGAAAG GAATGCTGAC ATTTCATTTG TTTCTCATCA TCATTTTATA TTAATTCTCA TTTTGTACAT
AAAATTCTCC CTTGGGTTGT TCCAGGATGC TTGTAAGCTC TTGGCTGCAT TCACACTTTC GATTGGTT

Locus: Os03g0142500

Loading...

Locus: Os03g0142500

Loading...