Os03t0146300-01

Locus

Os03g0146300

Description

Similar to Cyclin-dependent kinases regulatory subunit.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Orysa;CKS1

Oryzabase Gene Name Synonym(s)

CDK subunit protein 1

Transcript Evidence

AK121395 (DDBJ, Best hit)

Protein Evidence

Q6PS57 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cell cycle (GO:0007049)

Molecular Function: cyclin-dependent protein kinase regulator activity (GO:0016538)

Functional domain (InterPro)

Cyclin-dependent kinase, regulatory subunit (IPR000789)

Full-length cDNA

J023130M16 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0146300-01)

RiceXPro (AK121395)

Others

Oryzabase (13309)

KEGG (Os03t0146300-01)

Transcript

641 bp

>Os03t0146300-01 Similar to Cyclin-dependent kinases regulatory subunit.
GTCCGCTCCTCCTCCCTTTTCGGCCGCTGCTTCACACCATCCGCATCCTCCCCGCTCGCC
GCCGCGCCGCTCCAAGTTTCTTTCGTGAGGAGTTGATCGAGGAGTTGGGGTTGAGATGGG
CCAGATCCAGTACTCCGAGAAGTACTTCGACGACACCTACGAGTACAGGCACGTCGTCCT
TCCGCCGGAGGTCGCCAAGCTCCTCCCCAAGAATCGCCTTCTCTCCGAGAACGAGTGGCG
CGCGATCGGAGTGCAGCAGAGCCGCGGGTGGGTGCACTACGCGATCCACCGGCCGGAGCC
GCACATCATGCTGTTCCGCCGCCCGCTCAACTTCCAGCAGCAGCAGGAGGCAGCCGCGGC
TGCAGCGGCGCAGATGCTGCCCAAGTGACTGCCCCCTCCACGCGGCGATGGCGGCGACCC
GGGGTTGAAATGTGCGAAACCCTAGCCCCTTTACATCTCTTAAAGGGGGTTCGCGATACT
GCTAATTTACTTTCGTTTGTTAGTTGGAAATCTTAGTGATGTTGGTGGTGTCCACCTTGT
GTTCGTGAGAATGCCCGAGTAGGAACTGGCATGTAAACGTCTGTGTTATCTTGGATACTT
TTCATTGCTAAGCTATTATATGTGATGCTGGTACTGTTGTT

CDS

273 bp

>Os03t0146300-01 Similar to Cyclin-dependent kinases regulatory subunit.
ATGGGCCAGATCCAGTACTCCGAGAAGTACTTCGACGACACCTACGAGTACAGGCACGTC
GTCCTTCCGCCGGAGGTCGCCAAGCTCCTCCCCAAGAATCGCCTTCTCTCCGAGAACGAG
TGGCGCGCGATCGGAGTGCAGCAGAGCCGCGGGTGGGTGCACTACGCGATCCACCGGCCG
GAGCCGCACATCATGCTGTTCCGCCGCCCGCTCAACTTCCAGCAGCAGCAGGAGGCAGCC
GCGGCTGCAGCGGCGCAGATGCTGCCCAAGTGA

Protein

91 aa

>Os03t0146300-01 Similar to Cyclin-dependent kinases regulatory subunit.
MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRP
EPHIMLFRRPLNFQQQQEAAAAAAAQMLPK*

5'UTR

chr03:2571794..2571880 (+ strand) : 87 bp

chr03:2572035..2572062 (+ strand) : 28 bp

CDS

chr03:2572063..2572115 (+ strand) : 53 bp

chr03:2572203..2572263 (+ strand) : 61 bp

chr03:2572376..2572534 (+ strand) : 159 bp

3'UTR

chr03:2572535..2572787 (+ strand) : 253 bp

FASTA

>Os03t0146300-01 class=Sequence position=chr03:2571794..2572787 (+ strand)
GTCCGCTCCT CCTCCCTTTT CGGCCGCTGC TTCACACCAT CCGCATCCTC CCCGCTCGCC GCCGCGCCGC TCCAAGTTTC
TTTCGTGGTA CGCGTCTCCC CCCACAAATC CGTTCGATTC CTCGCGTTTT CCTCCACTGG GTTTCTCGTA CATCCCGTTT
CTTCCGGATT GCTGCGTGAT TTGGGATTTT GGTTGTTTGG TTGGGGCTTT TTCTGAGTGA TTTTGGGGAT TTTTCTTGTA
GAGGAGTTGA TCGAGGAGTT GGGGTTGAGA TGGGCCAGAT CCAGTACTCC GAGAAGTACT TCGACGACAC CTACGAGTAC
AGGTAGATGA GAATCCCCTC TTCTTGAATC TTCTCGTTAT CTCCGTTGCA AAACCCTAGT TTCTGATCCT TTTGGCCGGC
GCGGCGCAGG CACGTCGTCC TTCCGCCGGA GGTCGCCAAG CTCCTCCCCA AGAATCGCCT TCTCTCCGAG GTAACCTTCA
AGATCTCCAA ATACATTCGT GTAGAATCGC GTTCCTGGTT GGATCGATTC GTTGATTGTC TGATTGGGGA ATGGGGGTTT
TTCCGATGGG GTTTATTTGC AGAACGAGTG GCGCGCGATC GGAGTGCAGC AGAGCCGCGG GTGGGTGCAC TACGCGATCC
ACCGGCCGGA GCCGCACATC ATGCTGTTCC GCCGCCCGCT CAACTTCCAG CAGCAGCAGG AGGCAGCCGC GGCTGCAGCG
GCGCAGATGC TGCCCAAGTG ACTGCCCCCT CCACGCGGCG ATGGCGGCGA CCCGGGGTTG AAATGTGCGA AACCCTAGCC
CCTTTACATC TCTTAAAGGG GGTTCGCGAT ACTGCTAATT TACTTTCGTT TGTTAGTTGG AAATCTTAGT GATGTTGGTG
GTGTCCACCT TGTGTTCGTG AGAATGCCCG AGTAGGAACT GGCATGTAAA CGTCTGTGTT ATCTTGGATA CTTTTCATTG
CTAAGCTATT ATATGTGATG CTGGTACTGT TGTT

Locus: Os03g0146300

Loading...

Locus: Os03g0146300

Loading...