Os03t0150800-01

Locus

Os03g0150800

Description

Pi transporter, Pi homeostasis, Selenite uptake

RAP-DB Gene Symbol Synonym(s)

PT2, OsPT2, PTH1-2, OsPht1;2

RAP-DB Gene Name Synonym(s)

PHOSPHATE TRANSPORTER 2, High affinity phosphate transporter 2, Inorganic phosphate transporter 1-2

CGSNL Gene Symbol

PT2

CGSNL Gene Name

PHOSPHATE TRANSPORTER 2

Oryzabase Gene Symbol Synonym(s)

OsPT2, PTH1-2, OsPht1;2, PHT1;2, OsPHT1;2

Oryzabase Gene Name Synonym(s)

High affinity phosphate transporter 2, Inorganic phosphate transporter 1-2, Plant Phosphate Transporter 1;2

Transcript Evidence

AF536962

AF536959

Protein Evidence

Q8GSD9

Literature

PMID: 12271140

PMID: 18980647

PMID: 20149131

PMID: 24491113

Note

Manual Curation

February 6, 2014

Gene Ontology (GO)

Biological Process: phosphate ion transport (GO:0006817)

Biological Process: transmembrane transport (GO:0055085)

Molecular Function: inorganic phosphate transmembrane transporter activity (GO:0005315)

Molecular Function: transmembrane transporter activity (GO:0022857)

Cellular Component: integral component of membrane (GO:0016021)

Functional domain (InterPro)

General substrate transporter (IPR005828)

Phosphate permease (IPR004738)

Major facilitator superfamily domain, general substrate transporter (IPR016196)

Major facilitator superfamily domain (IPR020846)

Expression Databases

TENOR (Os03t0150800-01)

Others

Oryzabase (8217)

Transcript

1821 bp

>Os03t0150800-01 Pi transporter, Pi homeostasis, Selenite uptake
ATGGCGGGATCGCAGCTCAACGTTTTGGTCAAGCTCGACCAGGCCAAGACGCAATGGTAC
CATTTCATGGCGATCGTCATCGCCGGGATGGGGTTCTTCACAGACGCCTACGACCTCTTT
TGCATCGCGCTGGTCACCAAGCTGTTGGGTCGCCTTTACTACACCGACATCACCAAGCCC
AACCCAGGGACACTCCCGCCCAACGTGTCGTCCGCCGTCACCGGCGTCGCGCTCTGCGGC
ACGCTCGCCGGCCAGCTCTTCTTCGGATGGCTCGGCGACAAGCTCGGCCGCAAGAGCGTC
TATGGATTCACGCTCATCCTCATGGTCGTGTGCTCCATCGCCTCCGGTCTCTCGTTTGGC
CACACGCCCAAGAGCGTGATTGCCACGCTCTGCTTCTTCCGCTTCTGGCTCGGCTTCGGC
ATCGGCGGCGACTACCCGCTCAGCGCCACCATCATGTCGGAGTACGCGAGCAAGAAGACC
CGCGGGGCCTTCATCGCCGCCGTGTTCGCCATGCAGGGGTTCGGGATCCTCTTCGGCGCC
ATCGTCGCGCTCGTCGTCTCGGCCGGCTTCCGTCACGCGTACCCGGCGCCGTCGTACGCC
CAGAACCCCGCCGCGTCGCTCGCGCCGCAGGCTGACTACACGTGGCGGCTCATCCTCATG
TTCGGCACCATCCCGGCTGGGCTCACCTACTACTGGCGCATGAAAATGCCCGAGACGGCG
CGGTACACGGCGCTCGTCGCCCGCAACGCCAAGCAGGCGGCGGCTGACATGTCCAAGGTG
CTCCACGCCGAGATCGAGGAGCGGCCGGAGGTGGTCGAGAGCCAGGTGGTCGCCGGGGAG
ACCTGGGGCCTCTTCTCACGGCAGTTCATGAAGCGCCACGGGATgcacctcctggcgacc
accagcacgtggttcctgctcgacatcgccttctacagccagaacctgttccagaaggac
atcttcagcaaggtcgggtggataccgccggcgaagaccatgaacgcgctcgaggaACTC
TACCGCATCTCCCGCGCCCAGGCACTCATCGCACTCTGCGGAACCATCCCGGGCTACTGG
TTCACCGTCGCCTTCATCGACATCGTCGGCAGGTTCTGGATCCAGATCATGGGCTTCTTC
ATGATGACCGTGTTCATGCTCGCGCTCGGCGTGCCCTACGACCACTGGACGCACCCGGCG
CACCACACCGGCTTCGTCGTGCTCTACGCACTCACCTTCTTCTTCGCCAACTTCGGGCCC
AACAGCACCACCTTCATCGTGCCGGCTGAGATCTTCCCGGCGAGGCTCCGGTCGACGTGC
CACGGCATCTCCGCCGCGTCCGGCAAGGCCGGCGCGATCATCGGCGCGTTCGGGTTCCTG
TACGCTGCGCAGGACCAGCACAATCCCGACGCGGGATACTCCCGCGGCATCGGCATCCGG
AACGCGCTCTTCGTGCTCGCCGGCACAAACTTCCTCGGTATGCTCATGACGCTGCTGGTG
CCGGAGTCCAAGGGCTTGTCGCTGGAGGAGATGTCCAAGGACAACGTCGTCGACGAGACC
GCCCAAGAAGCGATCGCCCAAGCGTGATGTCATAAACATGCCGTCTCGACGTGAGTGACT
GAAAAAAAATGTATGCTTTATTACTCTATTGGTGTGATTACTTAATCTAGTTTTGTATAC
TTTTGTAGTGTCTCTCCTTTTACAGTTGTGGATTTGTGGGGTTTCTCTTTCTTTCTTTTT
TTTTGGTTGAAACAATTAAACTTGTTTGTGAGATTTTGTGAACTTTCCCTGCAACTGATA
TAAATGGCATACATTCATTTC

CDS

1587 bp

>Os03t0150800-01 Pi transporter, Pi homeostasis, Selenite uptake
ATGGCGGGATCGCAGCTCAACGTTTTGGTCAAGCTCGACCAGGCCAAGACGCAATGGTAC
CATTTCATGGCGATCGTCATCGCCGGGATGGGGTTCTTCACAGACGCCTACGACCTCTTT
TGCATCGCGCTGGTCACCAAGCTGTTGGGTCGCCTTTACTACACCGACATCACCAAGCCC
AACCCAGGGACACTCCCGCCCAACGTGTCGTCCGCCGTCACCGGCGTCGCGCTCTGCGGC
ACGCTCGCCGGCCAGCTCTTCTTCGGATGGCTCGGCGACAAGCTCGGCCGCAAGAGCGTC
TATGGATTCACGCTCATCCTCATGGTCGTGTGCTCCATCGCCTCCGGTCTCTCGTTTGGC
CACACGCCCAAGAGCGTGATTGCCACGCTCTGCTTCTTCCGCTTCTGGCTCGGCTTCGGC
ATCGGCGGCGACTACCCGCTCAGCGCCACCATCATGTCGGAGTACGCGAGCAAGAAGACC
CGCGGGGCCTTCATCGCCGCCGTGTTCGCCATGCAGGGGTTCGGGATCCTCTTCGGCGCC
ATCGTCGCGCTCGTCGTCTCGGCCGGCTTCCGTCACGCGTACCCGGCGCCGTCGTACGCC
CAGAACCCCGCCGCGTCGCTCGCGCCGCAGGCTGACTACACGTGGCGGCTCATCCTCATG
TTCGGCACCATCCCGGCTGGGCTCACCTACTACTGGCGCATGAAAATGCCCGAGACGGCG
CGGTACACGGCGCTCGTCGCCCGCAACGCCAAGCAGGCGGCGGCTGACATGTCCAAGGTG
CTCCACGCCGAGATCGAGGAGCGGCCGGAGGTGGTCGAGAGCCAGGTGGTCGCCGGGGAG
ACCTGGGGCCTCTTCTCACGGCAGTTCATGAAGCGCCACGGGATgcacctcctggcgacc
accagcacgtggttcctgctcgacatcgccttctacagccagaacctgttccagaaggac
atcttcagcaaggtcgggtggataccgccggcgaagaccatgaacgcgctcgaggaACTC
TACCGCATCTCCCGCGCCCAGGCACTCATCGCACTCTGCGGAACCATCCCGGGCTACTGG
TTCACCGTCGCCTTCATCGACATCGTCGGCAGGTTCTGGATCCAGATCATGGGCTTCTTC
ATGATGACCGTGTTCATGCTCGCGCTCGGCGTGCCCTACGACCACTGGACGCACCCGGCG
CACCACACCGGCTTCGTCGTGCTCTACGCACTCACCTTCTTCTTCGCCAACTTCGGGCCC
AACAGCACCACCTTCATCGTGCCGGCTGAGATCTTCCCGGCGAGGCTCCGGTCGACGTGC
CACGGCATCTCCGCCGCGTCCGGCAAGGCCGGCGCGATCATCGGCGCGTTCGGGTTCCTG
TACGCTGCGCAGGACCAGCACAATCCCGACGCGGGATACTCCCGCGGCATCGGCATCCGG
AACGCGCTCTTCGTGCTCGCCGGCACAAACTTCCTCGGTATGCTCATGACGCTGCTGGTG
CCGGAGTCCAAGGGCTTGTCGCTGGAGGAGATGTCCAAGGACAACGTCGTCGACGAGACC
GCCCAAGAAGCGATCGCCCAAGCGTGA

Protein

528 aa

>Os03t0150800-01 Pi transporter, Pi homeostasis, Selenite uptake
MAGSQLNVLVKLDQAKTQWYHFMAIVIAGMGFFTDAYDLFCIALVTKLLGRLYYTDITKP
NPGTLPPNVSSAVTGVALCGTLAGQLFFGWLGDKLGRKSVYGFTLILMVVCSIASGLSFG
HTPKSVIATLCFFRFWLGFGIGGDYPLSATIMSEYASKKTRGAFIAAVFAMQGFGILFGA
IVALVVSAGFRHAYPAPSYAQNPAASLAPQADYTWRLILMFGTIPAGLTYYWRMKMPETA
RYTALVARNAKQAAADMSKVLHAEIEERPEVVESQVVAGETWGLFSRQFMKRHGMHLLAT
TSTWFLLDIAFYSQNLFQKDIFSKVGWIPPAKTMNALEELYRISRAQALIALCGTIPGYW
FTVAFIDIVGRFWIQIMGFFMMTVFMLALGVPYDHWTHPAHHTGFVVLYALTFFFANFGP
NSTTFIVPAEIFPARLRSTCHGISAASGKAGAIIGAFGFLYAAQDQHNPDAGYSRGIGIR
NALFVLAGTNFLGMLMTLLVPESKGLSLEEMSKDNVVDETAQEAIAQA*

CDS

chr03:2815736..2817322 (- strand) : 1587 bp

3'UTR

chr03:2815502..2815735 (- strand) : 234 bp

FASTA

>Os03t0150800-01 class=Sequence position=chr03:2815502..2817322 (- strand)
ATGGCGGGAT CGCAGCTCAA CGTTTTGGTC AAGCTCGACC AGGCCAAGAC GCAATGGTAC CATTTCATGG CGATCGTCAT
CGCCGGGATG GGGTTCTTCA CAGACGCCTA CGACCTCTTT TGCATCGCGC TGGTCACCAA GCTGTTGGGT CGCCTTTACT
ACACCGACAT CACCAAGCCC AACCCAGGGA CACTCCCGCC CAACGTGTCG TCCGCCGTCA CCGGCGTCGC GCTCTGCGGC
ACGCTCGCCG GCCAGCTCTT CTTCGGATGG CTCGGCGACA AGCTCGGCCG CAAGAGCGTC TATGGATTCA CGCTCATCCT
CATGGTCGTG TGCTCCATCG CCTCCGGTCT CTCGTTTGGC CACACGCCCA AGAGCGTGAT TGCCACGCTC TGCTTCTTCC
GCTTCTGGCT CGGCTTCGGC ATCGGCGGCG ACTACCCGCT CAGCGCCACC ATCATGTCGG AGTACGCGAG CAAGAAGACC
CGCGGGGCCT TCATCGCCGC CGTGTTCGCC ATGCAGGGGT TCGGGATCCT CTTCGGCGCC ATCGTCGCGC TCGTCGTCTC
GGCCGGCTTC CGTCACGCGT ACCCGGCGCC GTCGTACGCC CAGAACCCCG CCGCGTCGCT CGCGCCGCAG GCTGACTACA
CGTGGCGGCT CATCCTCATG TTCGGCACCA TCCCGGCTGG GCTCACCTAC TACTGGCGCA TGAAAATGCC CGAGACGGCG
CGGTACACGG CGCTCGTCGC CCGCAACGCC AAGCAGGCGG CGGCTGACAT GTCCAAGGTG CTCCACGCCG AGATCGAGGA
GCGGCCGGAG GTGGTCGAGA GCCAGGTGGT CGCCGGGGAG ACCTGGGGCC TCTTCTCACG GCAGTTCATG AAGCGCCACG
GGATgcacct cctggcgacc accagcacgt ggttcctgct cgacatcgcc ttctacagcc agaacctgtt ccagaaggac
atcttcagca aggtcgggtg gataccgccg gcgaagacca tgaacgcgct cgaggaACTC TACCGCATCT CCCGCGCCCA
GGCACTCATC GCACTCTGCG GAACCATCCC GGGCTACTGG TTCACCGTCG CCTTCATCGA CATCGTCGGC AGGTTCTGGA
TCCAGATCAT GGGCTTCTTC ATGATGACCG TGTTCATGCT CGCGCTCGGC GTGCCCTACG ACCACTGGAC GCACCCGGCG
CACCACACCG GCTTCGTCGT GCTCTACGCA CTCACCTTCT TCTTCGCCAA CTTCGGGCCC AACAGCACCA CCTTCATCGT
GCCGGCTGAG ATCTTCCCGG CGAGGCTCCG GTCGACGTGC CACGGCATCT CCGCCGCGTC CGGCAAGGCC GGCGCGATCA
TCGGCGCGTT CGGGTTCCTG TACGCTGCGC AGGACCAGCA CAATCCCGAC GCGGGATACT CCCGCGGCAT CGGCATCCGG
AACGCGCTCT TCGTGCTCGC CGGCACAAAC TTCCTCGGTA TGCTCATGAC GCTGCTGGTG CCGGAGTCCA AGGGCTTGTC
GCTGGAGGAG ATGTCCAAGG ACAACGTCGT CGACGAGACC GCCCAAGAAG CGATCGCCCA AGCGTGATGT CATAAACATG
CCGTCTCGAC GTGAGTGACT GAAAAAAAAT GTATGCTTTA TTACTCTATT GGTGTGATTA CTTAATCTAG TTTTGTATAC
TTTTGTAGTG TCTCTCCTTT TACAGTTGTG GATTTGTGGG GTTTCTCTTT CTTTCTTTTT TTTTGGTTGA AACAATTAAA
CTTGTTTGTG AGATTTTGTG AACTTTCCCT GCAACTGATA TAAATGGCAT ACATTCATTT C

Locus: Os03g0150800

Loading...

Locus: Os03g0150800

Loading...