Os03t0161900-01

Locus

Os03g0161900

Description

Similar to Isoform 2 of Heat stress transcription factor A-2d.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HSFA2D

CGSNL Gene Name

HEAT STRESS TRANSCRIPTION FACTOR A2D

Oryzabase Gene Symbol Synonym(s)

HSfA2d, OsHsfA2d, OsHsf-08, rHsf7, HSF08, OsHSF8, HSF8, HSF7, OsHSF7, OsHSFA2dI, OsHSFA2dII, OsHSFA2dIII, OsHsfA6b, HsfA6b

Oryzabase Gene Name Synonym(s)

Heat stress transcription factor A2d, Heat stress transcription factor A-2d, Heat stress transcription factor 8, Heat stress transcription factor 7

Transcript Evidence

AK066844 (DDBJ, Best hit)

Protein Evidence

Q8H7Y6-2 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

J013088J01 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0161900-01)

Others

Oryzabase (8551)

Transcript

2271 bp

>Os03t0161900-01 Similar to Isoform 2 of Heat stress transcription factor A-2d.
GCTGCCAAGCTCGCCGGATTCTTTTCTTGGATTGGAGCAGATTGGGGGGTGACGATGGAG
AAGATGATGCCGGGGATGGTGAAGGAGGAGTGGCCGCCGAGCTCGCCGGAGGAGGGGGAG
GCGCCGAGGCCCATGGAGGGGCTGCACGAGGTCGGGCCGCCGCCGTTCCTGACCAAGACG
TTCGACCTGGTGGCCGACCCGGCCACCGACGGCGTCGTCTCGTGGGGCCGCGCGGGCAGC
AGCTTCGTCGTCTGGGACCCCCACGTCTTCGCCGCCGTCTTCCTCCCACGCTTCTTCAAG
CACAACAATTTCTCCAGCTTCGTCCGCCAGCTCAACACCTACGTGAGTCCCCCCAATTTC
CATTGCCACCACTAGTGTTGTTCCCTGCTTGTCTTCAGTTGTTGGGAAATTGTGTGTTCT
GTTTTCTTGTTTTGGATGTTGTTGTTCAGTTCTTGGTCCGGACGAATTACCTGAACAAGC
GATCACATTTCTACAGTTTGAGATTTCAGGTTGGATTGTTAGATAATTAAAATGGGTGTG
TTCTCACTTTTGTGGTTGCCATTATGTTTTGTGCCACATCGTGTGTGTTGAGTATTGATA
GGAATCTTGACACTAGAATTAAATGGATGGAGCATTGTAAAATTTTCAGTGCAAATTGTA
AACCCGGCGGTATTGGTTAAATAAATCGGTTGTATTGTGCATTTTTCCACTCAGTGCAAG
AACTTTGTGCATGCACAAATGCACAATTATGTAGCAATGGAGCTAGAAACTGGGATTTAC
TTATTGGTGCTGACCTGTTGGTTGTAGAAAATTACGATGGCTACAATTGTTCAACGGACT
GTTTTGTGGACTTGACATTATTTGCCCAAACTCAGCTATGTCCAATCCTTTTCAGACACA
TGCATATAAACCCTCAATTCCTGAAATGTTCTCAATGATTCAGAAAGAGGAAAAAAATCT
CCATGGACGAACTACTCAGTTTCTGACATGCTGTTTTCTTCAATTTGTTACTGTGTAGCT
AGATGGATCAAGACAGCGGATGAAGCTACAAGAATCTGCTTGTTTGTTCTAGAAGACTCC
TTTGATCACCATCAAAAAAAAGAAAAAGTGATGTAGTATACTGCTACCTGTTCTCTTAAT
AATGCTATGATAAATTTTGTCGCAAAACTATGTGAAACCAACCGTTTTACATACTTTGTG
TGACTTGCTATCCTAATTGAGTTTTGTCTGTGGCTTCTGTACTTGAACTAACTATACCTG
TAATATTCTTTGTGTTTGCAATTTGCAGGGTTTCAGAAAGATTGATCCTGACAGATGGGA
ATTCGCGAATGATGGTTTCCTGAGAGGCCAGAGGCATCTTCTAAAGATGATTAAGAGGAG
GAGACCATTGTCTTATCTCCCTGGATCTCAGCAGGCACTTGGCACCTGCCTTGAGGTTGG
TCAGTTCGGATTAGATGAAGAGATCGACAGGCTAAAGCGTGACAAGAACATCTTACTCGC
GGAGGTTGTGAAACTAAGGCACAAGCAGCAAAGCACGAAAGCCAATATGCGAGCCATGGA
AGAGAGGCTGCAACATGCGGAGCAGAAGCAGGTCCAGATGATGGGTTTCTTGGCAAGAGC
AATGCAGAACCCTGACTTCTTTCACCAGTTGATTCACCAGCAGGATAAAATGAAGGGGCT
CGAGGACACATTCTCGAAGAAGAGGACGAGGTCGATAGACATAGTGCCATTTCTCAACCC
CGGGGAGGTCAGCCAGGGCGATCAACTCGAGTCGACATTGCTGTTTGATCCAAGGCCATT
TGCTGAACTGAATGATGAGCCTGCAAAGTCTGAACTGGAGAATTTAGCACTGAACATCCA
GGGTCTTGGGAAGGGCAAGCAGGATGTCAACAGGACTCGAAATCAGCCACGAAATCAGGC
TAGCAACGAAACCGAGTTAACCGACGACTTCTGGGAGGAGCTTCTGAATGAAGGAGCAAG
AGATGATGCTGGGATTCCAGGGATGGAGCGAAGAAGACCTAGATATGTCGATGCATTAGC
GCAGAAGCTGGGTTATCTAAGCAATAGTAGCCAAAAGTAGATCAAGTGGCTCCGATTTGT
CCAACCATTTTTGTGATAGCTCTTATTGTATATCGGTGTAATTGTATTATAGTGATAGTT
TTATAGCGATAGGTCCAATTTATATTGCGGATCCGGCGTGCTGTGTAGTATATGTCTGGT
GATGTAAAGTTGAGCCATCATTCTTAATGGTATATATTGACAATTTTTTGC

CDS

528 bp

>Os03t0161900-01 Similar to Isoform 2 of Heat stress transcription factor A-2d.
TGCCAAGCTCGCCGGATTCTTTTCTTGGATTGGAGCAGATTGGGGGGTGACGATGGAGAA
GATGATGCCGGGGATGGTGAAGGAGGAGTGGCCGCCGAGCTCGCCGGAGGAGGGGGAGGC
GCCGAGGCCCATGGAGGGGCTGCACGAGGTCGGGCCGCCGCCGTTCCTGACCAAGACGTT
CGACCTGGTGGCCGACCCGGCCACCGACGGCGTCGTCTCGTGGGGCCGCGCGGGCAGCAG
CTTCGTCGTCTGGGACCCCCACGTCTTCGCCGCCGTCTTCCTCCCACGCTTCTTCAAGCA
CAACAATTTCTCCAGCTTCGTCCGCCAGCTCAACACCTACGTGAGTCCCCCCAATTTCCA
TTGCCACCACTAGTGTTGTTCCCTGCTTGTCTTCAGTTGTTGGGAAATTGTGTGTTCTGT
TTTCTTGTTTTGGATGTTGTTGTTCAGTTCTTGGTCCGGACGAATTACCTGAACAAGCGA
TCACATTTCTACAGTTTGAGATTTCAGGTTGGATTGTTAGATAATTAA

Protein

176 aa

>Os03t0161900-01 Similar to Isoform 2 of Heat stress transcription factor A-2d.
CQARRILFLDWSRLGGDDGEDDAGDGEGGVAAELAGGGGGAEAHGGAARGRAAAVPDQDV
RPGGRPGHRRRRLVGPRGQQLRRLGPPRLRRRLPPTLLQAQQFLQLRPPAQHLRESPQFP
LPPLVLFPACLQLLGNCVFCFLVLDVVVQFLVRTNYLNKRSHFYSLRFQVGLLDN*

5'UTR

chr03:3342277..3342278 (+ strand) : 2 bp

CDS

chr03:3342279..3342806 (+ strand) : 528 bp

3'UTR

chr03:3342807..3344547 (+ strand) : 1741 bp

FASTA

>Os03t0161900-01 class=Sequence position=chr03:3342277..3344547 (+ strand)
GCTGCCAAGC TCGCCGGATT CTTTTCTTGG ATTGGAGCAG ATTGGGGGGT GACGATGGAG AAGATGATGC CGGGGATGGT
GAAGGAGGAG TGGCCGCCGA GCTCGCCGGA GGAGGGGGAG GCGCCGAGGC CCATGGAGGG GCTGCACGAG GTCGGGCCGC
CGCCGTTCCT GACCAAGACG TTCGACCTGG TGGCCGACCC GGCCACCGAC GGCGTCGTCT CGTGGGGCCG CGCGGGCAGC
AGCTTCGTCG TCTGGGACCC CCACGTCTTC GCCGCCGTCT TCCTCCCACG CTTCTTCAAG CACAACAATT TCTCCAGCTT
CGTCCGCCAG CTCAACACCT ACGTGAGTCC CCCCAATTTC CATTGCCACC ACTAGTGTTG TTCCCTGCTT GTCTTCAGTT
GTTGGGAAAT TGTGTGTTCT GTTTTCTTGT TTTGGATGTT GTTGTTCAGT TCTTGGTCCG GACGAATTAC CTGAACAAGC
GATCACATTT CTACAGTTTG AGATTTCAGG TTGGATTGTT AGATAATTAA AATGGGTGTG TTCTCACTTT TGTGGTTGCC
ATTATGTTTT GTGCCACATC GTGTGTGTTG AGTATTGATA GGAATCTTGA CACTAGAATT AAATGGATGG AGCATTGTAA
AATTTTCAGT GCAAATTGTA AACCCGGCGG TATTGGTTAA ATAAATCGGT TGTATTGTGC ATTTTTCCAC TCAGTGCAAG
AACTTTGTGC ATGCACAAAT GCACAATTAT GTAGCAATGG AGCTAGAAAC TGGGATTTAC TTATTGGTGC TGACCTGTTG
GTTGTAGAAA ATTACGATGG CTACAATTGT TCAACGGACT GTTTTGTGGA CTTGACATTA TTTGCCCAAA CTCAGCTATG
TCCAATCCTT TTCAGACACA TGCATATAAA CCCTCAATTC CTGAAATGTT CTCAATGATT CAGAAAGAGG AAAAAAATCT
CCATGGACGA ACTACTCAGT TTCTGACATG CTGTTTTCTT CAATTTGTTA CTGTGTAGCT AGATGGATCA AGACAGCGGA
TGAAGCTACA AGAATCTGCT TGTTTGTTCT AGAAGACTCC TTTGATCACC ATCAAAAAAA AGAAAAAGTG ATGTAGTATA
CTGCTACCTG TTCTCTTAAT AATGCTATGA TAAATTTTGT CGCAAAACTA TGTGAAACCA ACCGTTTTAC ATACTTTGTG
TGACTTGCTA TCCTAATTGA GTTTTGTCTG TGGCTTCTGT ACTTGAACTA ACTATACCTG TAATATTCTT TGTGTTTGCA
ATTTGCAGGG TTTCAGAAAG ATTGATCCTG ACAGATGGGA ATTCGCGAAT GATGGTTTCC TGAGAGGCCA GAGGCATCTT
CTAAAGATGA TTAAGAGGAG GAGACCATTG TCTTATCTCC CTGGATCTCA GCAGGCACTT GGCACCTGCC TTGAGGTTGG
TCAGTTCGGA TTAGATGAAG AGATCGACAG GCTAAAGCGT GACAAGAACA TCTTACTCGC GGAGGTTGTG AAACTAAGGC
ACAAGCAGCA AAGCACGAAA GCCAATATGC GAGCCATGGA AGAGAGGCTG CAACATGCGG AGCAGAAGCA GGTCCAGATG
ATGGGTTTCT TGGCAAGAGC AATGCAGAAC CCTGACTTCT TTCACCAGTT GATTCACCAG CAGGATAAAA TGAAGGGGCT
CGAGGACACA TTCTCGAAGA AGAGGACGAG GTCGATAGAC ATAGTGCCAT TTCTCAACCC CGGGGAGGTC AGCCAGGGCG
ATCAACTCGA GTCGACATTG CTGTTTGATC CAAGGCCATT TGCTGAACTG AATGATGAGC CTGCAAAGTC TGAACTGGAG
AATTTAGCAC TGAACATCCA GGGTCTTGGG AAGGGCAAGC AGGATGTCAA CAGGACTCGA AATCAGCCAC GAAATCAGGC
TAGCAACGAA ACCGAGTTAA CCGACGACTT CTGGGAGGAG CTTCTGAATG AAGGAGCAAG AGATGATGCT GGGATTCCAG
GGATGGAGCG AAGAAGACCT AGATATGTCG ATGCATTAGC GCAGAAGCTG GGTTATCTAA GCAATAGTAG CCAAAAGTAG
ATCAAGTGGC TCCGATTTGT CCAACCATTT TTGTGATAGC TCTTATTGTA TATCGGTGTA ATTGTATTAT AGTGATAGTT
TTATAGCGAT AGGTCCAATT TATATTGCGG ATCCGGCGTG CTGTGTAGTA TATGTCTGGT GATGTAAAGT TGAGCCATCA
TTCTTAATGG TATATATTGA CAATTTTTTG C

Locus: Os03g0161900

Loading...

Locus: Os03g0161900

Loading...