Os03t0161900-02

Locus

Os03g0161900

Description

Heat stress transcriptioon factor, High-temperature stress tolerance

RAP-DB Gene Symbol Synonym(s)

HSFA2D, HSfA2d, OsHsfA2d, OsHsf-08, rHsf7, HSF08, HSF7, OsHSF7, OsHSFA2dI, OsHSFA2dII, OsHSFA2dIII

RAP-DB Gene Name Synonym(s)

HEAT STRESS TRANSCRIPTION FACTOR A2D, Heat stress transcription factor A2d, Heat stress transcription factor A-2d, Heat stress transcription factor 8, Heat stress transcription factor 7

CGSNL Gene Symbol

HSFA2D

CGSNL Gene Name

HEAT STRESS TRANSCRIPTION FACTOR A2D

Oryzabase Gene Symbol Synonym(s)

HSfA2d, OsHsfA2d, OsHsf-08, rHsf7, HSF08, OsHSF8, HSF8, HSF7, OsHSF7, OsHSFA2dI, OsHSFA2dII, OsHSFA2dIII, OsHsfA6b, HsfA6b

Oryzabase Gene Name Synonym(s)

Heat stress transcription factor A2d, Heat stress transcription factor A-2d, Heat stress transcription factor 8, Heat stress transcription factor 7

Transcript Evidence

AY344489

Protein Evidence

Q8H7Y6-2

Literature

PMID: 19192388

PMID: 21792744

Note

Manual Curation

April 20, 2015

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Biological Process: response to heat (GO:0009408)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Heat shock transcription factor family (IPR027725)

Heat shock transcription factor, plant (IPR027709)

Winged helix-turn-helix DNA-binding domain (IPR011991)

Heat shock factor (HSF)-type, DNA-binding (IPR000232)

Others

Oryzabase (8551)

Transcript

1403 bp

>Os03t0161900-02 Heat stress transcriptioon factor, High-temperature stress tolerance
GCGCCACTCTCGCTGACTCGCTCGCTGCCAAGCTCGCCGGATTCTTTTCTTGGATTGGAG
CAGATTGGGGGGTGACGATGGAGAAGATGATGCCGGGGATGGTGAAGGAGGAGTGGCCGC
CGAGCTCGCCGGAGGAGGGGGAGGCGCCGAGGCCCATGGAGGGGCTGCACGAGGTCGGGC
CGCCGCCGTTCCTGACCAAGACGTTCGACCTGGTGGCCGACCCGGCCACCGACGGCGTCG
TCTCGTGGGGCCGCGCGGGCAGCAGCTTCGTCGTCTGGGACCCCCACGTCTTCGCCGCCG
TCTTCCTCCCACGCTTCTTCAAGCACAACAATTTCTCCAGCTTCGTCCGCCAGCTCAACA
CCTACTTCTTGGTCCGGACGAATTACCTGAACAAGCGATCACATTTCTACAGTTTGAGAT
TTCAGGGTTTCAGAAAGATTGATCCTGACAGATGGGAATTCGCGAATGATGGTTTCCTGA
GAGGCCAGAGGCATCTTCTAAAGATGATTAAGAGGAGGAGACCATTGTCTTATCTCCCTG
GATCTCAGCAGGCACTTGGCACCTGCCTTGAGGTTGGTCAGTTCGGATTAGATGAAGAGA
TCGACAGGCTAAAGCGTGACAAGAACATCTTACTCGCGGAGGTTGTGAAACTAAGGCACA
AGCAGCAAAGCACGAAAGCCAATATGCGAGCCATGGAAGAGAGGCTGCAACATGCGGAGC
AGAAGCAGGTCCAGATGATGGGTTTCTTGGCAAGAGCAATGCAGAACCCTGACTTCTTTC
ACCAGTTGATTCACCAGCAGGATAAAATGAAGGGGCTCGAGGACACATTCTCGAAGAAGA
GGACGAGGTCGATAGACATAGTGCCATTTCTCAACCCCGGGGAGGTCAGCCAGGGCGATC
AACTCGAGTCGACATTGCTGTTTGATCCAAGGCCATTTGCTGAACTGAATGATGAGCCTG
CAAAGTCTGAACTGGAGAATTTAGCACTGAACATCCAGGGTCTTGGGAAGGGCAAGCAGG
ATGTCAACAGGACTCGAAATCAGCCACGAAATCAGGCTAGCAACGAAACCGAGTTAACCG
ACGACTTCTGGGAGGAGCTTCTGAATGAAGGAGCAAGAGATGATGCTGGGATTCCAGGGA
TGGAGCGAAGAAGACCTAGATATGTCGATGCATTAGCGCAGAAGCTGGGTTATCTAAGCA
ATAGTAGCCAAAAGTAGATCAAGTGGCTCCGATTTGTCCAACCATTTTTGTGATAGCTCT
TATTGTATATCGGTGTAATTGTATTATAGTGATAGTTTTATAGCGATAGGTCCAATTTAT
ATTGCGGATCCGGCGTGCTGTGTAGTATATGTCTGGTGATGTAAAGTTGAGCCATCATTC
TTAATGGTATATATTGACAATTT

CDS

1140 bp

>Os03t0161900-02 Heat stress transcriptioon factor, High-temperature stress tolerance
ATGGAGAAGATGATGCCGGGGATGGTGAAGGAGGAGTGGCCGCCGAGCTCGCCGGAGGAG
GGGGAGGCGCCGAGGCCCATGGAGGGGCTGCACGAGGTCGGGCCGCCGCCGTTCCTGACC
AAGACGTTCGACCTGGTGGCCGACCCGGCCACCGACGGCGTCGTCTCGTGGGGCCGCGCG
GGCAGCAGCTTCGTCGTCTGGGACCCCCACGTCTTCGCCGCCGTCTTCCTCCCACGCTTC
TTCAAGCACAACAATTTCTCCAGCTTCGTCCGCCAGCTCAACACCTACTTCTTGGTCCGG
ACGAATTACCTGAACAAGCGATCACATTTCTACAGTTTGAGATTTCAGGGTTTCAGAAAG
ATTGATCCTGACAGATGGGAATTCGCGAATGATGGTTTCCTGAGAGGCCAGAGGCATCTT
CTAAAGATGATTAAGAGGAGGAGACCATTGTCTTATCTCCCTGGATCTCAGCAGGCACTT
GGCACCTGCCTTGAGGTTGGTCAGTTCGGATTAGATGAAGAGATCGACAGGCTAAAGCGT
GACAAGAACATCTTACTCGCGGAGGTTGTGAAACTAAGGCACAAGCAGCAAAGCACGAAA
GCCAATATGCGAGCCATGGAAGAGAGGCTGCAACATGCGGAGCAGAAGCAGGTCCAGATG
ATGGGTTTCTTGGCAAGAGCAATGCAGAACCCTGACTTCTTTCACCAGTTGATTCACCAG
CAGGATAAAATGAAGGGGCTCGAGGACACATTCTCGAAGAAGAGGACGAGGTCGATAGAC
ATAGTGCCATTTCTCAACCCCGGGGAGGTCAGCCAGGGCGATCAACTCGAGTCGACATTG
CTGTTTGATCCAAGGCCATTTGCTGAACTGAATGATGAGCCTGCAAAGTCTGAACTGGAG
AATTTAGCACTGAACATCCAGGGTCTTGGGAAGGGCAAGCAGGATGTCAACAGGACTCGA
AATCAGCCACGAAATCAGGCTAGCAACGAAACCGAGTTAACCGACGACTTCTGGGAGGAG
CTTCTGAATGAAGGAGCAAGAGATGATGCTGGGATTCCAGGGATGGAGCGAAGAAGACCT
AGATATGTCGATGCATTAGCGCAGAAGCTGGGTTATCTAAGCAATAGTAGCCAAAAGTAG

Protein

380 aa

>Os03t0161900-02 Heat stress transcriptioon factor, High-temperature stress tolerance
MEKMMPGMVKEEWPPSSPEEGEAPRPMEGLHEVGPPPFLTKTFDLVADPATDGVVSWGRA
GSSFVVWDPHVFAAVFLPRFFKHNNFSSFVRQLNTYFLVRTNYLNKRSHFYSLRFQGFRK
IDPDRWEFANDGFLRGQRHLLKMIKRRRPLSYLPGSQQALGTCLEVGQFGLDEEIDRLKR
DKNILLAEVVKLRHKQQSTKANMRAMEERLQHAEQKQVQMMGFLARAMQNPDFFHQLIHQ
QDKMKGLEDTFSKKRTRSIDIVPFLNPGEVSQGDQLESTLLFDPRPFAELNDEPAKSELE
NLALNIQGLGKGKQDVNRTRNQPRNQASNETELTDDFWEELLNEGARDDAGIPGMERRRP
RYVDALAQKLGYLSNSSQK*

5'UTR

chr03:3342254..3342330 (+ strand) : 77 bp

CDS

chr03:3342331..3342618 (+ strand) : 288 bp

chr03:3342726..3342785 (+ strand) : 60 bp

chr03:3343565..3344356 (+ strand) : 792 bp

3'UTR

chr03:3344357..3344542 (+ strand) : 186 bp

FASTA

>Os03t0161900-02 class=Sequence position=chr03:3342254..3344542 (+ strand)
GCGCCACTCT CGCTGACTCG CTCGCTGCCA AGCTCGCCGG ATTCTTTTCT TGGATTGGAG CAGATTGGGG GGTGACGATG
GAGAAGATGA TGCCGGGGAT GGTGAAGGAG GAGTGGCCGC CGAGCTCGCC GGAGGAGGGG GAGGCGCCGA GGCCCATGGA
GGGGCTGCAC GAGGTCGGGC CGCCGCCGTT CCTGACCAAG ACGTTCGACC TGGTGGCCGA CCCGGCCACC GACGGCGTCG
TCTCGTGGGG CCGCGCGGGC AGCAGCTTCG TCGTCTGGGA CCCCCACGTC TTCGCCGCCG TCTTCCTCCC ACGCTTCTTC
AAGCACAACA ATTTCTCCAG CTTCGTCCGC CAGCTCAACA CCTACGTGAG TCCCCCCAAT TTCCATTGCC ACCACTAGTG
TTGTTCCCTG CTTGTCTTCA GTTGTTGGGA AATTGTGTGT TCTGTTTTCT TGTTTTGGAT GTTGTTGTTC AGTTCTTGGT
CCGGACGAAT TACCTGAACA AGCGATCACA TTTCTACAGT TTGAGATTTC AGGTTGGATT GTTAGATAAT TAAAATGGGT
GTGTTCTCAC TTTTGTGGTT GCCATTATGT TTTGTGCCAC ATCGTGTGTG TTGAGTATTG ATAGGAATCT TGACACTAGA
ATTAAATGGA TGGAGCATTG TAAAATTTTC AGTGCAAATT GTAAACCCGG CGGTATTGGT TAAATAAATC GGTTGTATTG
TGCATTTTTC CACTCAGTGC AAGAACTTTG TGCATGCACA AATGCACAAT TATGTAGCAA TGGAGCTAGA AACTGGGATT
TACTTATTGG TGCTGACCTG TTGGTTGTAG AAAATTACGA TGGCTACAAT TGTTCAACGG ACTGTTTTGT GGACTTGACA
TTATTTGCCC AAACTCAGCT ATGTCCAATC CTTTTCAGAC ACATGCATAT AAACCCTCAA TTCCTGAAAT GTTCTCAATG
ATTCAGAAAG AGGAAAAAAA TCTCCATGGA CGAACTACTC AGTTTCTGAC ATGCTGTTTT CTTCAATTTG TTACTGTGTA
GCTAGATGGA TCAAGACAGC GGATGAAGCT ACAAGAATCT GCTTGTTTGT TCTAGAAGAC TCCTTTGATC ACCATCAAAA
AAAAGAAAAA GTGATGTAGT ATACTGCTAC CTGTTCTCTT AATAATGCTA TGATAAATTT TGTCGCAAAA CTATGTGAAA
CCAACCGTTT TACATACTTT GTGTGACTTG CTATCCTAAT TGAGTTTTGT CTGTGGCTTC TGTACTTGAA CTAACTATAC
CTGTAATATT CTTTGTGTTT GCAATTTGCA GGGTTTCAGA AAGATTGATC CTGACAGATG GGAATTCGCG AATGATGGTT
TCCTGAGAGG CCAGAGGCAT CTTCTAAAGA TGATTAAGAG GAGGAGACCA TTGTCTTATC TCCCTGGATC TCAGCAGGCA
CTTGGCACCT GCCTTGAGGT TGGTCAGTTC GGATTAGATG AAGAGATCGA CAGGCTAAAG CGTGACAAGA ACATCTTACT
CGCGGAGGTT GTGAAACTAA GGCACAAGCA GCAAAGCACG AAAGCCAATA TGCGAGCCAT GGAAGAGAGG CTGCAACATG
CGGAGCAGAA GCAGGTCCAG ATGATGGGTT TCTTGGCAAG AGCAATGCAG AACCCTGACT TCTTTCACCA GTTGATTCAC
CAGCAGGATA AAATGAAGGG GCTCGAGGAC ACATTCTCGA AGAAGAGGAC GAGGTCGATA GACATAGTGC CATTTCTCAA
CCCCGGGGAG GTCAGCCAGG GCGATCAACT CGAGTCGACA TTGCTGTTTG ATCCAAGGCC ATTTGCTGAA CTGAATGATG
AGCCTGCAAA GTCTGAACTG GAGAATTTAG CACTGAACAT CCAGGGTCTT GGGAAGGGCA AGCAGGATGT CAACAGGACT
CGAAATCAGC CACGAAATCA GGCTAGCAAC GAAACCGAGT TAACCGACGA CTTCTGGGAG GAGCTTCTGA ATGAAGGAGC
AAGAGATGAT GCTGGGATTC CAGGGATGGA GCGAAGAAGA CCTAGATATG TCGATGCATT AGCGCAGAAG CTGGGTTATC
TAAGCAATAG TAGCCAAAAG TAGATCAAGT GGCTCCGATT TGTCCAACCA TTTTTGTGAT AGCTCTTATT GTATATCGGT
GTAATTGTAT TATAGTGATA GTTTTATAGC GATAGGTCCA ATTTATATTG CGGATCCGGC GTGCTGTGTA GTATATGTCT
GGTGATGTAA AGTTGAGCCA TCATTCTTAA TGGTATATAT TGACAATTT

Locus: Os03g0161900

Loading...

Locus: Os03g0161900

Loading...