Os03t0165200-00

Locus

Os03g0165200

Description

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

AP2/EREBP85

CGSNL Gene Name

APETALA2/ETHYLENE-RESPONSIVE ELEMENT BINDING PROTEIN 85

Oryzabase Gene Symbol Synonym(s)

AP2/EREBP#085, DRD1, OsDRD1

Oryzabase Gene Name Synonym(s)

APETALA2/ethylene-responsive element binding protein 85

Transcript Evidence

Protein Evidence

Literature

Note

Manual Curation

Expression Databases

TENOR (Os03t0165200-00)

Others

Oryzabase (10651)

Transcript

1536 bp

>Os03t0165200-00
ATGGCGGCGCTCTCTGCTCCCGGCGCCGGTGCTCCAACGGCCGCGAAGCCTCCACCGCTT
TCCTCCCAAGCGCACAACGCGCCGCCGATGACCGGCGCGGCGCGGCCGGCGAGCCTTGGC
GCTGCTACGGCCGCGACGCCTTCCCCGCCCGTGCAGAACGCGCCACAGATGACCGCCGTG
CCGCGCCCGGCGAGCTTTGGCGCCGCGGCCGCGAGGGTTTCATCTCCTTCCCCTTCCACG
CAGAACGCGCCACAGATGACCGGCGGGCCGCGGCCGGTGAACCTTGGGGCTCCCGTTGCT
CGTGGTACGGCCGCAAGGGCTCCCTCGCCTTCTCCGACAATGCAGAGGCAGAACGCGACA
CCGATGACCGGCGTGCCGCGGCCGGCGAGCTTTGGAGCTTCCGGCGCTGCCGCTACCACC
GCTAGGGGTCCTTCGCCATCACTGCCCGTGCAGAACGCTCCGTCGATGAGAGGCGCTATC
AGGGCTCCCTGGGCGGCGCCACCAATGCAGGGAGCTTCGCCGGCTGGGATGGTGCCGGCA
GGTCAGAGCTCCCACATAGCTGTGACCGGCATCCCGGCCGCACCGTTGCAACACAAGCGG
ATGCGGGGAGCGCGAGCTGCAATGGCGCAGGCCATGGTTCCGAGGAGCTCTCATACAGCA
GTACTGTCCACCGTGAGGCCCCACGCGCCATTGTCGAACGCTCAGGGAGCTCCGTCAATG
GCAATGTCGCCGGGCGTTCCGACCATCCCGACTCCGACCGGGAATCCTCACGTGTCGCAG
CAACAGAGAGCAGCAATGGCGAGGTACCCCGCTCCGACGAGCTCTCGTGCAATCGGAGCC
CCCATCCAGCCCACGGAGCCTCACGCGCCACTGCCGAACACCGGGGGAGAAGGAGCACCA
CCACCAGCACGCACCATGCCACCGCCATCCTCTCAGGCCGCGACCTCCACTCCTCCCGCC
GCCGCGACGCCACTGCAGCGGCCGCCGGCGCAAGCCACCGCTCAGCCGTCGACACAGAGA
TACTACGTCGGCGTGCAGCGAGACAAGGGCACGGGCAAATGGGCGGCATGCGTGGTCGAC
CCGTCCAACCCGACCAAGCACCGCCTCGTGGGCGCCTTCCCGGACGAGCACGCGGCGGCG
CTGGCGCACGACCGCCTCGACCTCGCGTTCCGCGGCGGCGGCCACCGCGGCGCCGGCGAC
AACTTCCGCCCGGCGTTCCACGCCGTGGAGCTGGAGTTCCTCAGGCTGTGCGCGGCCACC
TCGTCGCCGGGCTCCCACTGCGGCCTCGTCGCCGGCGGCGACAAGTACGACGAGAAGTAC
TCCGAATTCCTGCGCAAAATCTACCACGGGGTGATGGACAACTCCCCCTCCTACAAGAAA
TTCTTCGACGTGATCCTGGATTTCTTCATCGCTCGGGCGAGAGAGATCGGGCGGGAGGCC
CTCGAGGACGGCGGGGATATGCTGGTGGAGAGGTTCGTCGCGATGCACAAGAACAAGGCC
GTGACGCCGAGGTGGCGTGCGTGGTACCGGAGGTAG

CDS

1536 bp

>Os03t0165200-00
ATGGCGGCGCTCTCTGCTCCCGGCGCCGGTGCTCCAACGGCCGCGAAGCCTCCACCGCTT
TCCTCCCAAGCGCACAACGCGCCGCCGATGACCGGCGCGGCGCGGCCGGCGAGCCTTGGC
GCTGCTACGGCCGCGACGCCTTCCCCGCCCGTGCAGAACGCGCCACAGATGACCGCCGTG
CCGCGCCCGGCGAGCTTTGGCGCCGCGGCCGCGAGGGTTTCATCTCCTTCCCCTTCCACG
CAGAACGCGCCACAGATGACCGGCGGGCCGCGGCCGGTGAACCTTGGGGCTCCCGTTGCT
CGTGGTACGGCCGCAAGGGCTCCCTCGCCTTCTCCGACAATGCAGAGGCAGAACGCGACA
CCGATGACCGGCGTGCCGCGGCCGGCGAGCTTTGGAGCTTCCGGCGCTGCCGCTACCACC
GCTAGGGGTCCTTCGCCATCACTGCCCGTGCAGAACGCTCCGTCGATGAGAGGCGCTATC
AGGGCTCCCTGGGCGGCGCCACCAATGCAGGGAGCTTCGCCGGCTGGGATGGTGCCGGCA
GGTCAGAGCTCCCACATAGCTGTGACCGGCATCCCGGCCGCACCGTTGCAACACAAGCGG
ATGCGGGGAGCGCGAGCTGCAATGGCGCAGGCCATGGTTCCGAGGAGCTCTCATACAGCA
GTACTGTCCACCGTGAGGCCCCACGCGCCATTGTCGAACGCTCAGGGAGCTCCGTCAATG
GCAATGTCGCCGGGCGTTCCGACCATCCCGACTCCGACCGGGAATCCTCACGTGTCGCAG
CAACAGAGAGCAGCAATGGCGAGGTACCCCGCTCCGACGAGCTCTCGTGCAATCGGAGCC
CCCATCCAGCCCACGGAGCCTCACGCGCCACTGCCGAACACCGGGGGAGAAGGAGCACCA
CCACCAGCACGCACCATGCCACCGCCATCCTCTCAGGCCGCGACCTCCACTCCTCCCGCC
GCCGCGACGCCACTGCAGCGGCCGCCGGCGCAAGCCACCGCTCAGCCGTCGACACAGAGA
TACTACGTCGGCGTGCAGCGAGACAAGGGCACGGGCAAATGGGCGGCATGCGTGGTCGAC
CCGTCCAACCCGACCAAGCACCGCCTCGTGGGCGCCTTCCCGGACGAGCACGCGGCGGCG
CTGGCGCACGACCGCCTCGACCTCGCGTTCCGCGGCGGCGGCCACCGCGGCGCCGGCGAC
AACTTCCGCCCGGCGTTCCACGCCGTGGAGCTGGAGTTCCTCAGGCTGTGCGCGGCCACC
TCGTCGCCGGGCTCCCACTGCGGCCTCGTCGCCGGCGGCGACAAGTACGACGAGAAGTAC
TCCGAATTCCTGCGCAAAATCTACCACGGGGTGATGGACAACTCCCCCTCCTACAAGAAA
TTCTTCGACGTGATCCTGGATTTCTTCATCGCTCGGGCGAGAGAGATCGGGCGGGAGGCC
CTCGAGGACGGCGGGGATATGCTGGTGGAGAGGTTCGTCGCGATGCACAAGAACAAGGCC
GTGACGCCGAGGTGGCGTGCGTGGTACCGGAGGTAG

Protein

512 aa

>Os03t0165200-00
MAALSAPGAGAPTAAKPPPLSSQAHNAPPMTGAARPASLGAATAATPSPPVQNAPQMTAV
PRPASFGAAAARVSSPSPSTQNAPQMTGGPRPVNLGAPVARGTAARAPSPSPTMQRQNAT
PMTGVPRPASFGASGAAATTARGPSPSLPVQNAPSMRGAIRAPWAAPPMQGASPAGMVPA
GQSSHIAVTGIPAAPLQHKRMRGARAAMAQAMVPRSSHTAVLSTVRPHAPLSNAQGAPSM
AMSPGVPTIPTPTGNPHVSQQQRAAMARYPAPTSSRAIGAPIQPTEPHAPLPNTGGEGAP
PPARTMPPPSSQAATSTPPAAATPLQRPPAQATAQPSTQRYYVGVQRDKGTGKWAACVVD
PSNPTKHRLVGAFPDEHAAALAHDRLDLAFRGGGHRGAGDNFRPAFHAVELEFLRLCAAT
SSPGSHCGLVAGGDKYDEKYSEFLRKIYHGVMDNSPSYKKFFDVILDFFIARAREIGREA
LEDGGDMLVERFVAMHKNKAVTPRWRAWYRR*

CDS

chr03:3504772..3506307 (+ strand) : 1536 bp

FASTA

>Os03t0165200-00 class=Sequence position=chr03:3504772..3506307 (+ strand)
ATGGCGGCGC TCTCTGCTCC CGGCGCCGGT GCTCCAACGG CCGCGAAGCC TCCACCGCTT TCCTCCCAAG CGCACAACGC
GCCGCCGATG ACCGGCGCGG CGCGGCCGGC GAGCCTTGGC GCTGCTACGG CCGCGACGCC TTCCCCGCCC GTGCAGAACG
CGCCACAGAT GACCGCCGTG CCGCGCCCGG CGAGCTTTGG CGCCGCGGCC GCGAGGGTTT CATCTCCTTC CCCTTCCACG
CAGAACGCGC CACAGATGAC CGGCGGGCCG CGGCCGGTGA ACCTTGGGGC TCCCGTTGCT CGTGGTACGG CCGCAAGGGC
TCCCTCGCCT TCTCCGACAA TGCAGAGGCA GAACGCGACA CCGATGACCG GCGTGCCGCG GCCGGCGAGC TTTGGAGCTT
CCGGCGCTGC CGCTACCACC GCTAGGGGTC CTTCGCCATC ACTGCCCGTG CAGAACGCTC CGTCGATGAG AGGCGCTATC
AGGGCTCCCT GGGCGGCGCC ACCAATGCAG GGAGCTTCGC CGGCTGGGAT GGTGCCGGCA GGTCAGAGCT CCCACATAGC
TGTGACCGGC ATCCCGGCCG CACCGTTGCA ACACAAGCGG ATGCGGGGAG CGCGAGCTGC AATGGCGCAG GCCATGGTTC
CGAGGAGCTC TCATACAGCA GTACTGTCCA CCGTGAGGCC CCACGCGCCA TTGTCGAACG CTCAGGGAGC TCCGTCAATG
GCAATGTCGC CGGGCGTTCC GACCATCCCG ACTCCGACCG GGAATCCTCA CGTGTCGCAG CAACAGAGAG CAGCAATGGC
GAGGTACCCC GCTCCGACGA GCTCTCGTGC AATCGGAGCC CCCATCCAGC CCACGGAGCC TCACGCGCCA CTGCCGAACA
CCGGGGGAGA AGGAGCACCA CCACCAGCAC GCACCATGCC ACCGCCATCC TCTCAGGCCG CGACCTCCAC TCCTCCCGCC
GCCGCGACGC CACTGCAGCG GCCGCCGGCG CAAGCCACCG CTCAGCCGTC GACACAGAGA TACTACGTCG GCGTGCAGCG
AGACAAGGGC ACGGGCAAAT GGGCGGCATG CGTGGTCGAC CCGTCCAACC CGACCAAGCA CCGCCTCGTG GGCGCCTTCC
CGGACGAGCA CGCGGCGGCG CTGGCGCACG ACCGCCTCGA CCTCGCGTTC CGCGGCGGCG GCCACCGCGG CGCCGGCGAC
AACTTCCGCC CGGCGTTCCA CGCCGTGGAG CTGGAGTTCC TCAGGCTGTG CGCGGCCACC TCGTCGCCGG GCTCCCACTG
CGGCCTCGTC GCCGGCGGCG ACAAGTACGA CGAGAAGTAC TCCGAATTCC TGCGCAAAAT CTACCACGGG GTGATGGACA
ACTCCCCCTC CTACAAGAAA TTCTTCGACG TGATCCTGGA TTTCTTCATC GCTCGGGCGA GAGAGATCGG GCGGGAGGCC
CTCGAGGACG GCGGGGATAT GCTGGTGGAG AGGTTCGTCG CGATGCACAA GAACAAGGCC GTGACGCCGA GGTGGCGTGC
GTGGTACCGG AGGTAG

Locus: Os03g0165200

Loading...

Locus: Os03g0165200

Loading...