Os03t0167600-01

Locus

Os03g0167600

Description

Similar to Male sterility protein 2.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsMS2, MS2, OsDPW, DPW, DPW1, OsDPW1

Oryzabase Gene Name Synonym(s)

MALE STERILITY 2, male sterility protein 2, defective pollen wall

Transcript Evidence

AK121254 (DDBJ, Best hit)

Protein Evidence

B1PAT2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor (GO:0016620)

Functional domain (InterPro)

Male sterility (IPR004262)

Male sterility, NAD-binding (IPR013120)

NAD(P)-binding domain (IPR016040)

Full-length cDNA

J023102A19 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0167600-01)

RiceXPro (AK121254)

Others

Oryzabase (13558)

KEGG (Os03t0167600-01)

Transcript

2337 bp

>Os03t0167600-01 Similar to Male sterility protein 2.
GATGGCCTCCTCCTGCAATCTGCAAGACTGAAGCTAAGCAGCTTTAAATCCTCCTGCGTC
ATTTAACCCCCTCTCTGCCTCTCTGAGCTCTGAGCTGCTCAGCTACAGCTCCCTAGCTGT
TCTGTTCGATTAATTCAGCTTCGCTTTGCTTGGATTAATTTGTAGGTGACTAACTCGATC
ACAGCTCAGGTGATTGGCAGTTTGATCACAAGGCAGGAAGGAAGTAGAAGTAGATTGCTG
TAGCACACGCTCACCTACCAAGCTTCTACACTCGCAGCCAAGCTTTGATCGTTTGCTTGC
TTTGCATTGCTTGGGCTTTGTGGGCAAGAACGTGTCTATCTTCTTCTTGTTCGTCTCGTC
AGGCGGCCATGGGGATGAGTTCATGCGTGAACCTATCCCGTGTCGCCGCCGCCGCCGCAG
GGAGACGGCCGGGATTTGCCGGTGAGCTGGGAGGTCGCCGTGGTCATGGCAGAAGCGTGC
TTCCGGTTGTTGCTGCACTGCCGGTGAGGAGGAAGGGAAGCGGTTGTGGCGTGGCGTGCT
GCGTCTCCTCCTCGTCTTCCTCCTCCGTGCACGGCAAGAACTCGGCGGCGGCGGCGGAGG
GTCACGCCGGCGGCATTGGGATCGCGGAGTTCCTCGGCGGCAAGAACTTCCTCATCACCG
GCGGAACCGGGTTCCTGGCAAAAGTTCTCATCGAGAAGATATTGCGGACGAATCCCGACG
TTGGCAAGATCTACGTGCTGATCAAGGCGAAGGACGGTGACGCAGCACTGAAAAGATTGC
ACAACGAGGTTGTGGACACAGAATTGTTCAGTCGTTTGCAGGAAATCCATGGCAAGGATT
ACCACAGCTTCGCGGCAAGAAAGCTGGTGCCTGTAGTCGGAGATGTCAGAGAAGCCAACG
TTGGCATCGCCCCTGAGCTTGCCGGCGTGATCGCCGACGAGGTCGACATCATCGTCAACT
CAGCAGCAAACACCACTTTCGACGAGAGGTACGATGTTGCAATGGACATCAACACCGTAG
GGCCATTCAGGATAATGAGCTTCGCGCAGCGGTTTCGGAGGCTGAAGCTGTTCTTGCAAG
TGTCAACAGCATATGTGAACGGACAGAGGCAAGGTGTGGTGCTAGAGAAGCCATTTCGCT
TGGGGGACACCATAGCCAAGGAGTTAGGATCTCCAGATTCTTCACAACACAAGAACACCA
TGCTTGACATCGAGGCAGAGATCAAGCTGGCTTTTGACCACAGGAGACACGGTGATGATT
CAGCCTCTTTCTCTGAAGAAATGAAAGAGTTAGGATTAGAGAGGGCAAAACTCCATGGGT
GGCAAGATACATATGTGTTCACCAAGGCCATGGGAGAGATGGTGATCAACTCCATGCGAG
GAGATATACCGGTTGTCACCATCAGGCCAAGCGTCATCGAGAGCACCTGGAGGGATCCCT
TCCCCGGTTGGATGGAAGGGAACAGGATGATGGATCCTGTTGTGCTGTACTACGGCAAAG
GCCAGCTGAGCGGGTTCCTCGCTGACCCGGAGGGTGTTCTTGACGTGGTTCCGGCGGACA
TGGTGGTGAACGCAACGCTGGCGTCCATGGCGAAGCACGGGCGCGGCGGCGCGGCGGCGG
CGGCGGCGGCGGCGGAGGGGATGCACGTGTACCACGTGGCGTCGTCGACGGTGAACCCGC
TGGCGTTCGGCGACCTGAGCCGGTTCCTCTTCCAGCACTTCACGGGGTCGCCGTACAGCG
ACGCGGCGGGGCGGCCCATCCACGTGCCGCCGATGCGGCTGTTCGACACCATGGAGCAGT
TCGCCAGCTACGTCGAGACCGACGCGCTGCTGCGCGCCGGCCGCCTCGCCGGCGCCGGCG
CCGGCGCCGGAGACGAGAGGGTGTCGCAGCGGCTGCGCGAGCTCTGCGCCAAGTCCGTCG
AGCAGACCATCTACCTCGGCAGCATCTACCAGCCCTACACCTTCTACGGCGGCAGGTTCG
ACAATGGGAACACGGAGGCGCTGATCGGGGAGATGTCGGAGGAGGAGAAGGCGCGGTTCC
ACTTCGACGTGAGGAGCATCGAGTGGACGGACTACATCACCAACGTGCACATCCCGGGGC
TCAGGAAGCACGTCATGAAGGGGAGGGGCGTCGGCggcggcagcggcgcgtcgtcgtcat
cgaacgcctcgctgctcgccggcgcctccgtttgaatggccaggccggcgcCGGAGAAGA
GGAGGATGCATGCGCGGCGTGTACACTAGGCTAGATTGTTGTTAACTTGTTCTGCCGTGG
CAGTCTGACAGATGATCTTTGTGCTGCAGTAATTAAGGTTGATAGTATGTTATCTCT

CDS

1827 bp

>Os03t0167600-01 Similar to Male sterility protein 2.
ATGGGGATGAGTTCATGCGTGAACCTATCCCGTGTCGCCGCCGCCGCCGCAGGGAGACGG
CCGGGATTTGCCGGTGAGCTGGGAGGTCGCCGTGGTCATGGCAGAAGCGTGCTTCCGGTT
GTTGCTGCACTGCCGGTGAGGAGGAAGGGAAGCGGTTGTGGCGTGGCGTGCTGCGTCTCC
TCCTCGTCTTCCTCCTCCGTGCACGGCAAGAACTCGGCGGCGGCGGCGGAGGGTCACGCC
GGCGGCATTGGGATCGCGGAGTTCCTCGGCGGCAAGAACTTCCTCATCACCGGCGGAACC
GGGTTCCTGGCAAAAGTTCTCATCGAGAAGATATTGCGGACGAATCCCGACGTTGGCAAG
ATCTACGTGCTGATCAAGGCGAAGGACGGTGACGCAGCACTGAAAAGATTGCACAACGAG
GTTGTGGACACAGAATTGTTCAGTCGTTTGCAGGAAATCCATGGCAAGGATTACCACAGC
TTCGCGGCAAGAAAGCTGGTGCCTGTAGTCGGAGATGTCAGAGAAGCCAACGTTGGCATC
GCCCCTGAGCTTGCCGGCGTGATCGCCGACGAGGTCGACATCATCGTCAACTCAGCAGCA
AACACCACTTTCGACGAGAGGTACGATGTTGCAATGGACATCAACACCGTAGGGCCATTC
AGGATAATGAGCTTCGCGCAGCGGTTTCGGAGGCTGAAGCTGTTCTTGCAAGTGTCAACA
GCATATGTGAACGGACAGAGGCAAGGTGTGGTGCTAGAGAAGCCATTTCGCTTGGGGGAC
ACCATAGCCAAGGAGTTAGGATCTCCAGATTCTTCACAACACAAGAACACCATGCTTGAC
ATCGAGGCAGAGATCAAGCTGGCTTTTGACCACAGGAGACACGGTGATGATTCAGCCTCT
TTCTCTGAAGAAATGAAAGAGTTAGGATTAGAGAGGGCAAAACTCCATGGGTGGCAAGAT
ACATATGTGTTCACCAAGGCCATGGGAGAGATGGTGATCAACTCCATGCGAGGAGATATA
CCGGTTGTCACCATCAGGCCAAGCGTCATCGAGAGCACCTGGAGGGATCCCTTCCCCGGT
TGGATGGAAGGGAACAGGATGATGGATCCTGTTGTGCTGTACTACGGCAAAGGCCAGCTG
AGCGGGTTCCTCGCTGACCCGGAGGGTGTTCTTGACGTGGTTCCGGCGGACATGGTGGTG
AACGCAACGCTGGCGTCCATGGCGAAGCACGGGCGCGGCGGCGCGGCGGCGGCGGCGGCG
GCGGCGGAGGGGATGCACGTGTACCACGTGGCGTCGTCGACGGTGAACCCGCTGGCGTTC
GGCGACCTGAGCCGGTTCCTCTTCCAGCACTTCACGGGGTCGCCGTACAGCGACGCGGCG
GGGCGGCCCATCCACGTGCCGCCGATGCGGCTGTTCGACACCATGGAGCAGTTCGCCAGC
TACGTCGAGACCGACGCGCTGCTGCGCGCCGGCCGCCTCGCCGGCGCCGGCGCCGGCGCC
GGAGACGAGAGGGTGTCGCAGCGGCTGCGCGAGCTCTGCGCCAAGTCCGTCGAGCAGACC
ATCTACCTCGGCAGCATCTACCAGCCCTACACCTTCTACGGCGGCAGGTTCGACAATGGG
AACACGGAGGCGCTGATCGGGGAGATGTCGGAGGAGGAGAAGGCGCGGTTCCACTTCGAC
GTGAGGAGCATCGAGTGGACGGACTACATCACCAACGTGCACATCCCGGGGCTCAGGAAG
CACGTCATGAAGGGGAGGGGCGTCGGCggcggcagcggcgcgtcgtcgtcatcgaacgcc
tcgctgctcgccggcgcctccgtttga

Protein

609 aa

>Os03t0167600-01 Similar to Male sterility protein 2.
MGMSSCVNLSRVAAAAAGRRPGFAGELGGRRGHGRSVLPVVAALPVRRKGSGCGVACCVS
SSSSSSVHGKNSAAAAEGHAGGIGIAEFLGGKNFLITGGTGFLAKVLIEKILRTNPDVGK
IYVLIKAKDGDAALKRLHNEVVDTELFSRLQEIHGKDYHSFAARKLVPVVGDVREANVGI
APELAGVIADEVDIIVNSAANTTFDERYDVAMDINTVGPFRIMSFAQRFRRLKLFLQVST
AYVNGQRQGVVLEKPFRLGDTIAKELGSPDSSQHKNTMLDIEAEIKLAFDHRRHGDDSAS
FSEEMKELGLERAKLHGWQDTYVFTKAMGEMVINSMRGDIPVVTIRPSVIESTWRDPFPG
WMEGNRMMDPVVLYYGKGQLSGFLADPEGVLDVVPADMVVNATLASMAKHGRGGAAAAAA
AAEGMHVYHVASSTVNPLAFGDLSRFLFQHFTGSPYSDAAGRPIHVPPMRLFDTMEQFAS
YVETDALLRAGRLAGAGAGAGDERVSQRLRELCAKSVEQTIYLGSIYQPYTFYGGRFDNG
NTEALIGEMSEEEKARFHFDVRSIEWTDYITNVHIPGLRKHVMKGRGVGGGSGASSSSNA
SLLAGASV*

5'UTR

chr03:3653709..3654076 (+ strand) : 368 bp

CDS

chr03:3654077..3654392 (+ strand) : 316 bp

chr03:3654486..3654589 (+ strand) : 104 bp

chr03:3654700..3654899 (+ strand) : 200 bp

chr03:3655017..3655117 (+ strand) : 101 bp

chr03:3655236..3655449 (+ strand) : 214 bp

chr03:3655563..3655724 (+ strand) : 162 bp

chr03:3655837..3655918 (+ strand) : 82 bp

chr03:3655998..3656425 (+ strand) : 428 bp

chr03:3656708..3656927 (+ strand) : 220 bp

3'UTR

chr03:3656928..3657069 (+ strand) : 142 bp

FASTA

>Os03t0167600-01 class=Sequence position=chr03:3653709..3657069 (+ strand)
GATGGCCTCC TCCTGCAATC TGCAAGACTG AAGCTAAGCA GCTTTAAATC CTCCTGCGTC ATTTAACCCC CTCTCTGCCT
CTCTGAGCTC TGAGCTGCTC AGCTACAGCT CCCTAGCTGT TCTGTTCGAT TAATTCAGCT TCGCTTTGCT TGGATTAATT
TGTAGGTGAC TAACTCGATC ACAGCTCAGG TGATTGGCAG TTTGATCACA AGGCAGGAAG GAAGTAGAAG TAGATTGCTG
TAGCACACGC TCACCTACCA AGCTTCTACA CTCGCAGCCA AGCTTTGATC GTTTGCTTGC TTTGCATTGC TTGGGCTTTG
TGGGCAAGAA CGTGTCTATC TTCTTCTTGT TCGTCTCGTC AGGCGGCCAT GGGGATGAGT TCATGCGTGA ACCTATCCCG
TGTCGCCGCC GCCGCCGCAG GGAGACGGCC GGGATTTGCC GGTGAGCTGG GAGGTCGCCG TGGTCATGGC AGAAGCGTGC
TTCCGGTTGT TGCTGCACTG CCGGTGAGGA GGAAGGGAAG CGGTTGTGGC GTGGCGTGCT GCGTCTCCTC CTCGTCTTCC
TCCTCCGTGC ACGGCAAGAA CTCGGCGGCG GCGGCGGAGG GTCACGCCGG CGGCATTGGG ATCGCGGAGT TCCTCGGCGG
CAAGAACTTC CTCATCACCG GCGGAACCGG GTTCCTGGCA AAAGGTAGTA AATCTATCTT CTTCCTCTCT TAAATTTGGA
TCATCCAACG TACGTAGCTC GCGTCTCTTC TTGATTTTGC TTGATCATCT GGATCAGTTC TCATCGAGAA GATATTGCGG
ACGAATCCCG ACGTTGGCAA GATCTACGTG CTGATCAAGG CGAAGGACGG TGACGCAGCA CTGAAAAGAT TGCACAACGA
GGTTCTACTT GCGATCATTG TTCGATCCAT TTCAGAGAAA CATTTGTTAG TACCTATCTG TTCATCTGTT TGACTGTATT
TTTCCTTTTG TTTTAACTGT GTGATGTGCA GGTTGTGGAC ACAGAATTGT TCAGTCGTTT GCAGGAAATC CATGGCAAGG
ATTACCACAG CTTCGCGGCA AGAAAGCTGG TGCCTGTAGT CGGAGATGTC AGAGAAGCCA ACGTTGGCAT CGCCCCTGAG
CTTGCCGGCG TGATCGCCGA CGAGGTCGAC ATCATCGTCA ACTCAGCAGC AAACACCACT TTCGACGAGA GGTTTTGTCA
TTCTCTGAAC TGCAGTGTTG CTCCAAAGAT GAGTTCTTAA TTGGATCACT TCATGTATAA TAAGCATATG AATTGATCAC
TGTTGCTGCA TTTGGTTCGA TTTTGCAGGT ACGATGTTGC AATGGACATC AACACCGTAG GGCCATTCAG GATAATGAGC
TTCGCGCAGC GGTTTCGGAG GCTGAAGCTG TTCTTGCAAG TGTCAACAGG TCAGAAATGC ATGTCAAATG AAAAGCTCTT
GTGCTGAAAA CTTGCACTGA AATTACCTCC AAAAACCTTA GATATATCTC TCTACTGTGG ATTTTGAATT TCATGTTTGG
CAATCAGCAT ATGTGAACGG ACAGAGGCAA GGTGTGGTGC TAGAGAAGCC ATTTCGCTTG GGGGACACCA TAGCCAAGGA
GTTAGGATCT CCAGATTCTT CACAACACAA GAACACCATG CTTGACATCG AGGCAGAGAT CAAGCTGGCT TTTGACCACA
GGAGACACGG TGATGATTCA GCCTCTTTCT CTGAAGAAAT GAAAGAGTTA GGATTAGAGA GGTATACACG CAATGCCAGA
AACGTTTCAA GTCTGAATGT GCAGTGGCAA GATTATGCAA TTGCACACAT GAAACAGCAT TGGTTAATTC GCTTGATTTG
GGTTTAATTT GTAGGGCAAA ACTCCATGGG TGGCAAGATA CATATGTGTT CACCAAGGCC ATGGGAGAGA TGGTGATCAA
CTCCATGCGA GGAGATATAC CGGTTGTCAC CATCAGGCCA AGCGTCATCG AGAGCACCTG GAGGGATCCC TTCCCCGGTT
GGATGGAAGG GAACAGGTAC AAATTGTAAA TCAAAGTTCA CCAACTTAAA CCAATTTTAG TTCATGAGAT AATTTAGTTT
ACGATGAATT GGCATTGATT TTGGCGAAAT GAATTTGAGC TTGATTAGGA TGATGGATCC TGTTGTGCTG TACTACGGCA
AAGGCCAGCT GAGCGGGTTC CTCGCTGACC CGGAGGGTGT TCTTGACGTG GTAATGATTA AGCAGATGAT TAAATTCGCT
AATTGCGATT AGTGGTTAAT CGATTAACTA TGGCGATTTG TGATGGAAGG TTCCGGCGGA CATGGTGGTG AACGCAACGC
TGGCGTCCAT GGCGAAGCAC GGGCGCGGCG GCGCGGCGGC GGCGGCGGCG GCGGCGGAGG GGATGCACGT GTACCACGTG
GCGTCGTCGA CGGTGAACCC GCTGGCGTTC GGCGACCTGA GCCGGTTCCT CTTCCAGCAC TTCACGGGGT CGCCGTACAG
CGACGCGGCG GGGCGGCCCA TCCACGTGCC GCCGATGCGG CTGTTCGACA CCATGGAGCA GTTCGCCAGC TACGTCGAGA
CCGACGCGCT GCTGCGCGCC GGCCGCCTCG CCGGCGCCGG CGCCGGCGCC GGAGACGAGA GGGTGTCGCA GCGGCTGCGC
GAGCTCTGCG CCAAGTCCGT CGAGCAGACC ATCTACCTCG GCAGCATCTA CCAGCCCTAC ACCTTCTACG GCGGCAGGTT
tgtttcctag atcgttcgtt ttatttaaaa acttttgtga aatatataaa actatatgta tacgtataaa tatatttaac
aataaattaa ataatataaa aaaattaata attacttaat ttatttctaa taaaactaat ggtcaaatat atttaaaaaa
gtcgatggca taaaatattt taaaacgggg gagtaTATTC GTATATACCC GCCATGGATA ATGCATTGTG AATTTGAGAT
GCTGATGAGC TCGATCGCCG GCCATGGCGG CGGCGGCAGG TTCGACAATG GGAACACGGA GGCGCTGATC GGGGAGATGT
CGGAGGAGGA GAAGGCGCGG TTCCACTTCG ACGTGAGGAG CATCGAGTGG ACGGACTACA TCACCAACGT GCACATCCCG
GGGCTCAGGA AGCACGTCAT GAAGGGGAGG GGCGTCGGCg gcggcagcgg cgcgtcgtcg tcatcgaacg cctcgctgct
cgccggcgcc tccgtttgaa tggccaggcc ggcgcCGGAG AAGAGGAGGA TGCATGCGCG GCGTGTACAC TAGGCTAGAT
TGTTGTTAAC TTGTTCTGCC GTGGCAGTCT GACAGATGAT CTTTGTGCTG CAGTAATTAA GGTTGATAGT ATGTTATCTC
T

Locus: Os03g0167600

Loading...

Locus: Os03g0167600

Loading...